The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1140: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Heme transporter IsdDEF, membrane component IsdD
Translate Function Assignments



Context on contig NC_009641 from base 1139902 to 1152794 (12893 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1136 1139902 1141347 1446 +           Phage endolysin CHAP endopeptidase / Phage endolysin N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) locus|NWMN_1039, protein_id|YP_001332073.1, gi|151221251, geneID|5330643
1137 1144017 1142080 1938 - 732     1: 1   Cell surface receptor IsdB for hemoglobin and hemoglobin-haptoglobin complexes gene_name|isdB, locus|NWMN_1040, protein_id|YP_001332074.1, gi|151221252, geneID|5330644
1138 1145272 1144220 1053 - 202     2: 2 1 dlit(17229211)
dlit(11953376)
dlit(11952908)
dlit(14982642)
dlit(17042505)
dlit(12574635)
Cell surface protein IsdA, transfers heme from hemoglobin to apo-IsdC gene_name|isdA, locus|NWMN_1041, protein_id|YP_001332075.1, gi|151221253, geneID|5332052
1139 1145481 1146164 684 + 208     1: 1 dlit(11952908)
dlit(12574635)
dlit(11830639)
dlit(15718231)
dlit(15240116)
dlit(17287214)
NPQTN cell wall anchored protein IsdC gene_name|isdC, locus|NWMN_1042, protein_id|YP_001332076.1, gi|151221254, geneID|5332051
1140 1146164 1147240 1077 + -1     1: 1   Heme transporter IsdDEF, membrane component IsdD gene_name|isdD, locus|NWMN_1043, protein_id|YP_001332077.1, gi|151221255, geneID|5332053
1141 1147369 1148115 747 + 128     1: 1   Heme transporter IsdDEF, lipoprotein IsdE gene_name|isdE, locus|NWMN_1044, protein_id|YP_001332078.1, gi|151221256, geneID|5332054
1142 1148125 1149093 969 + 9     1: 1   Heme transporter IsdDEF, permease component IsdF gene_name|isdF, locus|NWMN_1045, protein_id|YP_001332079.1, gi|151221257, geneID|5332055
1143 1149155 1149889 735 + 61     2: 2 1   NPQTN specific sortase B gene_name|srtB, locus|NWMN_1046, protein_id|YP_001332080.1, gi|151221258, geneID|5332056
1144 1149908 1150231 324 + 18     1: 1 dlit(14570922)
dlit(15520015)
Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdG gene_name|isdG, locus|NWMN_1047, protein_id|YP_001332081.1, gi|151221259, geneID|5332506
1145 1150268 1150375 108 + 36         Doubtful CDS. No database matches  
1146 1150615 1151355 741 + 239         RNA 2'-O-methyltransferase YsgA, TrmH family locus|NWMN_1048, protein_id|YP_001332082.1, gi|151221260, geneID|5332057
1147 1151736 1152794 1059 + 380     2: 3 4   Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20) gene_name|pheS, locus|NWMN_1049, protein_id|YP_001332083.1, gi|151221261, geneID|5330645

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Heme,_hemin_uptake_and_utilization_systems_in_GramPositives SvetaG Heme transporter IsdDEF, membrane component IsdD


  Protein Sequence

>fig|426430.8.peg.1140 Heme transporter IsdDEF, membrane component IsdD
MRNVKQIATKSIIAIISLGILTYTTMIGSVLADEIKYPSAKFNQPEAKDKTELTTSIFDE
KIKENKALELLIFNQENKNVTEEQQLVDEKAQLISDMTGKIYLQVKLKGQIDKEQLVFQN
DKNEEFPFVIKDEKDDTIVRILIEQHMDKINMHVKTLAEKKNLDNKEMVYSIHFKEKKVQ
HDDAKEVPSKHQNQENNQDQLKKDIDDKKDSQKSDTKERRTSLFTEKGLNDIPVQKDKVQ
QDSNKKIENERPKASGTLKVENSPPTIKKVENNHKEQPKHKDEKSKKEKKKVVEKEKALP
AFNRDDDSKNSSQLSSDIKELDEPNHKKQYMLFAAGIVLATILLISAHLYSRKRGNQV

MD5 = e8b86bb122c2f9581262b207af63da5f


  DNA Sequence

>fig|426430.8.peg.1140 Heme transporter IsdDEF, membrane component IsdD
atgagaaatgttaaacaaattgctacaaaatctattatagctattattagcttaggtata
cttacatatacaacaatgattggtagcgtgttggctgatgagataaaatatccatcagcc
aaatttaatcaacctgaagcaaaagataaaacagaattaactacatcaatttttgatgaa
aagataaaagagaataaagcgttagagttactaatttttaatcaagaaaataaaaatgta
actgaggaacaacaactagttgacgaaaaggcgcaattgatttcagatatgactggtaaa
atttacttgcaagtaaagctaaaaggtcaaatagataaagaacaacttgtttttcaaaat
gacaaaaatgaagaatttccttttgttataaaagatgaaaaggatgacacaatagtaaga
attttaattgaacagcatatggataaaatcaatatgcatgttaaaacgttggctgaaaag
aaaaatctagataacaaagaaatggtgtattctattcattttaaagagaaaaaagtacaa
catgatgatgcaaaagaagtgccttcaaaacatcaaaatcaagaaaataatcaagatcag
cttaaaaaagatattgatgacaaaaaagatagtcaaaaatcagatactaaggaaagacgt
actagcctttttactgaaaaaggattaaatgatattcctgtacaaaaagataaagtgcaa
caagacagtaataaaaagattgaaaatgagcgacctaaagcatcaggtacattaaaagtt
gaaaatagccctccaacaataaaaaaggttgaaaataatcacaaagagcaaccgaaacat
aaagatgaaaaatcaaaaaaggaaaagaaaaaagtagttgaaaaagaaaaagcgttacca
gcttttaatagagatgatgatagcaagaatagtagtcaattatctagtgatattaaagaa
cttgatgaaccaaatcataaaaagcaatatatgttatttgcagctggcattgtgttagca
actattttacttatttcggcacatttatacagcagaaagagaggtaaccaagtttga


  DNA with Flanking Sequence

>fig|426430.8.peg.1140 Heme transporter IsdDEF, membrane component IsdD
aaaaatggtaaattgtatgttcaaataactgtcaaccacagtcattggattactggaatg
agtatcgaaggacataaagaaaatattattagtaaaaacactgccaaagatgaacgcact
tctgaatttgaagtaagtaagttgaacggtaaaatagatggaaaaattgacgtttatatc
gatgaaaaagtaaatggaaagccattcaaatatgaccatcattacaacattacatataaa
tttaatggaccaactgatgtagcaggtgctaatgcaccaggtaaagatgataaaaattct
gcttcaggtagtgacaaaggatctgatggaacgactactggtcaaagtgaatctaatagt
tcgaataaagacaaagtagaaaatccacaaacaaatgctggtacacctgcatatatatat
gcaataccagttgcatccttagcattattaatcgcaatcacattgtttgttagaaaaaaa
tctaaaggcaatgtggaataatgagaaatgttaaacaaattgctacaaaatctattatag
ctattattagcttaggtatacttacatatacaacaatgattggtagcgtgttggctgatg
agataaaatatccatcagccaaatttaatcaacctgaagcaaaagataaaacagaattaa
ctacatcaatttttgatgaaaagataaaagagaataaagcgttagagttactaattttta
atcaagaaaataaaaatgtaactgaggaacaacaactagttgacgaaaaggcgcaattga
tttcagatatgactggtaaaatttacttgcaagtaaagctaaaaggtcaaatagataaag
aacaacttgtttttcaaaatgacaaaaatgaagaatttccttttgttataaaagatgaaa
aggatgacacaatagtaagaattttaattgaacagcatatggataaaatcaatatgcatg
ttaaaacgttggctgaaaagaaaaatctagataacaaagaaatggtgtattctattcatt
ttaaagagaaaaaagtacaacatgatgatgcaaaagaagtgccttcaaaacatcaaaatc
aagaaaataatcaagatcagcttaaaaaagatattgatgacaaaaaagatagtcaaaaat
cagatactaaggaaagacgtactagcctttttactgaaaaaggattaaatgatattcctg
tacaaaaagataaagtgcaacaagacagtaataaaaagattgaaaatgagcgacctaaag
catcaggtacattaaaagttgaaaatagccctccaacaataaaaaaggttgaaaataatc
acaaagagcaaccgaaacataaagatgaaaaatcaaaaaaggaaaagaaaaaagtagttg
aaaaagaaaaagcgttaccagcttttaatagagatgatgatagcaagaatagtagtcaat
tatctagtgatattaaagaacttgatgaaccaaatcataaaaagcaatatatgttatttg
cagctggcattgtgttagcaactattttacttatttcggcacatttatacagcagaaaga
gaggtaaccaagtttgagaatcataaagtatttaaccattttagtgataagcgtcgttat
cttaaccagctgtcaatcttccagttctcaagaatcaactaaatccggcgaattcagaat
cgtaccaacaactgttgcattgacaatgacattggacaaattggatttaccaattgtcgg
caaacccacgtcatataagacattgcctaatcgttataaagatgtaccggaaattggtca
accaatggagccgaatgttgaagctgttaaaaagttaaaaccaacacatgttttgagtgt
gtcaacgattaaagatgaaatgcaaccattttacaaacaattaaatatgaaaggctactt
ttatgattttgatagtttaaaagggatgcaaaagtcgattacacaattaggtgatcaatt
taatcgtaaagcacaagcaaaagaattaaatgaccatttaaattctgtaaagcaaaaaat
tgaaaataaagcagctaaacaaaagaaacatcccaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT05SA0977 Staphylococcus aureus NCTC 8325     iron-regulated protein
cmr|SACOL1142 Staphylococcus aureus subsp. aureus COL     hypothetical protein
cmr|SAUSA300_1031 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAF67315.1 Staphylococcus aureus subsp. aureus str. Newman     iron-transporting membrane protein
fig|367830.3.peg.2275 Staphylococcus aureus subsp. aureus USA300 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|426430.6.peg.1015 Staphylococcus aureus subsp. aureus str. Newman FIG   Heme transporter IsdDEF, membrane component IsdD
fig|451515.3.peg.1129 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|451516.9.peg.1133 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|452948.4.peg.722 Staphylococcus aureus 930918-3 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|546342.3.peg.1705 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|553567.3.peg.1320 Staphylococcus aureus A5948 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|553590.4.peg.177 Staphylococcus aureus A9754 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|553594.3.peg.40 Staphylococcus aureus A9765 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|644279.4.peg.1139 Staphylococcus aureus subsp. aureus 132 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|93061.3.peg.1038 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|93061.5.peg.993 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Heme transporter IsdDEF, membrane component IsdD
fig|93062.19.peg.1113 Staphylococcus aureus subsp. aureus COL FIG   Heme transporter IsdDEF, membrane component IsdD
fig|93062.4.peg.1411 Staphylococcus aureus subsp. aureus COL FIG   Heme transporter IsdDEF, membrane component IsdD
gb|AAW38021.1 Staphylococcus aureus subsp. aureus COL     hypothetical protein SACOL1142
gb|ABD22638.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30199.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABX29085.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1066
gb|EEV83264.1 Staphylococcus aureus A5948     conserved hypothetical protein
gi|150374055 Staphylococcus aureus subsp. aureus str. Newman NCBI   iron-transporting membrane protein
gi|151221255 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1043
gi|160368114 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1066
gi|161509305 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1066
gi|221138675 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_08535
gi|257860437 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258451829 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|57285927 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1142
gi|57651741 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1142
gi|87128124 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162150 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_1031
gi|87202389 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194831 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01084
img|637151904 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637887683 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893722 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795423 Staphylococcus aureus aureus Newman IMG   iron-transporting membrane protein
img|641309035 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
kegg|saa:SAUSA300_1031 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1142 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_1043 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sao:SAOUHSC_01084 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sax:USA300HOU_1066 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|YP_001332077.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1043
ref|YP_001574964.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1066
ref|YP_186005.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1142
ref|YP_493729.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_1031
ref|YP_499629.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01084
ref|ZP_03563477.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_08535
ref|ZP_05699850.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QG33 Staphylococcus aureus (strain Newman) TrEMBL   Iron-transporting membrane protein
tr|A8Z1R2 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Putative uncharacterized protein
tr|Q2FHU9 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2FZE7 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HGV2 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein isdD


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search