The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1125: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Phage phi 11 orf43 protein homolog
Translate Function Assignments



Context on contig NC_009641 from base 1123029 to 1134913 (11885 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1120 1123029 1123412 384 +           Phage phi 11 orf38 protein homolog locus|NWMN_1024, protein_id|YP_001332058.1, gi|151221236, geneID|5330628
1121 1123431 1124012 582 + 18         Phage major tail tube protein locus|NWMN_1025, protein_id|YP_001332059.1, gi|151221237, geneID|5330629
1122 1124075 1124440 366 + 62         Phage phi 11 orf40 protein homolog locus|NWMN_1026, protein_id|YP_001332060.1, gi|151221238, geneID|5330630
1123 1124560 1124814 255 + 119         Phage phi 11 orf41 protein homolog locus|NWMN_1027, protein_id|YP_001332061.1, gi|151221239, geneID|5330631
1124 1124831 1128295 3465 + 16     1: 1   Phage tail, tail length tape-measure protein locus|NWMN_1028, protein_id|YP_001332062.1, gi|151221240, geneID|5330632
1125 1128308 1129255 948 + 12       Phage phi 11 orf43 protein homolog locus|NWMN_1029, protein_id|YP_001332063.1, gi|151221241, geneID|5330633
1126 1129264 1131165 1902 + 8 4     Phage phi 11 orf44 protein homolog locus|NWMN_1030, protein_id|YP_001332064.1, gi|151221242, geneID|5330634
1127 1131180 1133090 1911 + 14     1: 2   Phage host receptor binding protein, recognizes GlcNAc moieties on wall teichoic acids locus|NWMN_1031, protein_id|YP_001332065.1, gi|151221243, geneID|5330635
1128 1133090 1134913 1824 + -1         Phage long tail fiber # ACLAME 69 locus|NWMN_1032, protein_id|YP_001332066.1, gi|151221244, geneID|5330636

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1125 Phage phi 11 orf43 protein homolog
MDIELTKKDGTVIKLSEYGFIVNDIVIDSMQINTKYQDKENMNGRILMGSNYISRDIVVP
CFCVVKNRSDIAYMRDMLYSLTTDIEPMYLREIRRKEELNYRFTQPISDDYVKLDKNNFP
DYEYSRHDQQIYVNGKQYKVIFNGVINPKQKGNKVSFELKFETTELPYGESIGTSLELEE
NKKVGLWSFDFNIDWHAGGDKRKYTFENLSKGTVYYHGSAPNDQFNMYKKITIILGEDTE
SFVWNLTHAEIMKIEGIKLKAGDRIVYDSFRVYKNGVEISTETNIAQPKFKYGANKFEFN
QTVQKVQFDLKFYYK

MD5 = 7dde347956721b95ad50773a02ff99ec


  DNA Sequence

>fig|426430.8.peg.1125 Phage phi 11 orf43 protein homolog
atggacatagaattaacaaaaaaagatggtactgtaatcaaattaagtgaatacgggttt
atcgttaacgatatagtaattgatagtatgcaaatcaacacaaagtatcaagataaagaa
aatatgaacggtcgtatattaatggggagcaattatatcagtagagatatagttgttcct
tgtttttgtgtggtaaaaaatcgttcagacattgcttatatgcgagatatgttgtattcg
ttaacgacagacatagaacctatgtatttgcgagaaataagaagaaaagaagagttgaat
tacaggtttactcaaccaatttctgatgattacgtgaaattagataaaaacaacttcccg
gattatgaatattcaagacacgatcaacaaatttatgtaaatggtaaacagtataaagtt
atttttaacggagttataaaccctaaacaaaaaggtaataaagtttcttttgaactaaaa
ttcgaaactacagaattaccatacggtgaaagtattggaacaagcctagagttagaagaa
aacaaaaaggttggattgtggtcgtttgattttaatattgattggcatgcaggcggagac
aaaagaaagtatacatttgaaaatttgagcaaaggtacagtttactatcatggtagtgct
cctaacgaccaattcaacatgtataaaaagataacaattattttaggcgaagatacagaa
tcgtttgtatggaatttaacgcatgctgaaataatgaaaatcgaagggatcaaactaaaa
gctggagacagaattgtttatgatagcttccgagtttataaaaacggtgttgaaataagt
accgaaacgaatatagcccaaccaaaatttaaatacggagctaataaatttgagtttaat
caaacggtacaaaaagttcagtttgatttgaaattttattataagtag


  DNA with Flanking Sequence

>fig|426430.8.peg.1125 Phage phi 11 orf43 protein homolog
ttataggagattttgtgtctgcaggtgctgatatgatccgtggtttaattagaggtattg
gacaaatggctggtcaattagtagatgcagctaaaaatgttgctaagaaagctttagatg
cagctaaaagtgctttgggtattcactcaccttcacgtgaattcatggatgttggtatgt
attcaatgctaggtttcgttaaaggtatagataatcattcaagtaaagttatccgtaatg
tttctaatgttgcagataaagtagttgatgcatttcaacctacattaaacgcacctgaca
tttctagtattacaggaaacttaagtaatttaggtggaaatataaatgcgcaagtacaac
acacacattctattgaaacatcaccgaacatgaaaactgttaaagttgaattcgatgtta
ataacgatgcgcttactagtattgttaacggcagaaatgctaaacgcaattctgagtatt
acttataaaggaggttacaaatggacatagaattaacaaaaaaagatggtactgtaatca
aattaagtgaatacgggtttatcgttaacgatatagtaattgatagtatgcaaatcaaca
caaagtatcaagataaagaaaatatgaacggtcgtatattaatggggagcaattatatca
gtagagatatagttgttccttgtttttgtgtggtaaaaaatcgttcagacattgcttata
tgcgagatatgttgtattcgttaacgacagacatagaacctatgtatttgcgagaaataa
gaagaaaagaagagttgaattacaggtttactcaaccaatttctgatgattacgtgaaat
tagataaaaacaacttcccggattatgaatattcaagacacgatcaacaaatttatgtaa
atggtaaacagtataaagttatttttaacggagttataaaccctaaacaaaaaggtaata
aagtttcttttgaactaaaattcgaaactacagaattaccatacggtgaaagtattggaa
caagcctagagttagaagaaaacaaaaaggttggattgtggtcgtttgattttaatattg
attggcatgcaggcggagacaaaagaaagtatacatttgaaaatttgagcaaaggtacag
tttactatcatggtagtgctcctaacgaccaattcaacatgtataaaaagataacaatta
ttttaggcgaagatacagaatcgtttgtatggaatttaacgcatgctgaaataatgaaaa
tcgaagggatcaaactaaaagctggagacagaattgtttatgatagcttccgagtttata
aaaacggtgttgaaataagtaccgaaacgaatatagcccaaccaaaatttaaatacggag
ctaataaatttgagtttaatcaaacggtacaaaaagttcagtttgatttgaaattttatt
ataagtaggtgtcagaatgacaataactattaaaccacctaaaggtaatggcgcacctgt
accagtagaaacaactttagtaaaaaaagttaatgctgacggtgtattaacttttgatat
tctagaaaataaatatacttatgaagttattaacgctatagggaaaagatggattgttag
tcatgtcgaaggtgaaaacgacaagaaagaatatgtaataactgtcattgataggaaatc
agaaggcgacagacaactggttgaatgtactgctagagagattcctatagacaagttaat
gattgataggatttatgttaatgtaacaggatcttttacagtagaaagatattttaacat
tgtgtttcaaggtactggaatgctttttgaagtcgaaggtaaggttaagtcttcgaagtt
tgaaaatggtggtgaaggcgacacaaggttagaaatgtttaaaaagggattagaacattt
cggtttagaatataaaataacgtatgac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF67301.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|387908.2.peg.55 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage phi 11 orf43 protein homolog
fig|426430.6.peg.1002 Staphylococcus aureus subsp. aureus str. Newman FIG   Phage phi 11 orf43 protein homolog
gb|ABF73149.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gi|104641771 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|150374041 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221241 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_1029
img|640795409 Staphylococcus aureus aureus Newman IMG   hypothetical protein
kegg|sae:NWMN_1029 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|YP_001332063.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_1029
tr|A0EWU0 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A6QG19 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|426430.8.peg.1126 Phage phi 11 orf44 protein homolog


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search