The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1086: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Phage phi 11 orf11 protein homolog
Translate Function Assignments



Context on contig NC_009641 from base 1098898 to 1110179 (11282 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1074 1100283 1098898 1386 -           Phage DNA recombinase gene_name|int, locus|NWMN_0992, protein_id|YP_001332026.1, gi|151221204, geneID|5332394
1075 1100392 1100571 180 + 108         Phage excisionase  
1076 1101483 1100551 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] locus|NWMN_0993, protein_id|YP_001332027.1, gi|151221205, geneID|5332046
1077 1102238 1101519 720 - 35         Phage repressor protein cI locus|NWMN_0994, protein_id|YP_001332028.1, gi|151221206, geneID|5330598
1078 1102380 1102598 219 + 141         Phage transcriptional regulator cro  
1079 1102614 1103402 789 + 15         Phage antirepressor protein locus|NWMN_0995, protein_id|YP_001332029.1, gi|151221207, geneID|5330599
1080 1103419 1103613 195 + 16         Phage protein  
1081 1103666 1103842 177 + 52         Phage phi 11 orf9 protein homolog  
1082 1104047 1103817 231 - -26         Phage protein  
1083 1104097 1104234 138 + 49         hypothetical protein  
1084 1104227 1104388 162 + -8         Phage phi 11 orf10a protein homolog  
1085 1104478 1104795 318 + 89         Phage protein locus|NWMN_0996, protein_id|YP_001332030.1, gi|151221208, geneID|5330600
1086 1104800 1105060 261 + 4         Phage phi 11 orf11 protein homolog locus|NWMN_0997, protein_id|YP_001332031.1, gi|151221209, geneID|5330601
1087 1105075 1105554 480 + 14         Phage protein locus|NWMN_0998, protein_id|YP_001332032.1, gi|151221210, geneID|5330602
1088 1105554 1106327 774 + -1         Phage phi 11 orf12 protein homolog locus|NWMN_0999, protein_id|YP_001332033.1, gi|151221211, geneID|5330603
1089 1106357 1106908 552 + 29         Phage ssDNA binding protein locus|NWMN_1000, protein_id|YP_001332034.1, gi|151221212, geneID|5330604
1090 1106921 1107592 672 + 12         Phage phi 11 orf14 protein homolog locus|NWMN_1001, protein_id|YP_001332035.1, gi|151221213, geneID|5330605
1091 1108555 1107698 858 - 105         Phage protein locus|NWMN_1002, protein_id|YP_001332036.1, gi|151221214, geneID|5330606
1092 1108620 1109390 771 + 64         Phage DNA replication protein O locus|NWMN_1003, protein_id|YP_001332037.1, gi|151221215, geneID|5330607
1093 1109400 1110179 780 + 9     1: 1   Phage DNA helicase loader locus|NWMN_1004, protein_id|YP_001332038.1, gi|151221216, geneID|5330608

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1086 Phage phi 11 orf11 protein homolog
MYYKAGDVCRKIFNVDGFDFQLRVKKRAYSVEIVVLDHEGNSIDGLLVSDENDLYTALDI
LKQSIYEWIENNTDEQDRLINLVMKW

MD5 = 45afe43780b3827cf4dc86b3477b531e


  DNA Sequence

>fig|426430.8.peg.1086 Phage phi 11 orf11 protein homolog
atgtattacaaagcgggtgacgtatgtcgaaaaatatttaatgtagatggctttgatttt
caattaagagttaagaagcgagcatatagtgtcgaaatagtcgttttagatcatgaagga
aattcaattgacgggctactagtttctgacgagaacgatctatacacagctttagatatt
ttgaaacaaagtatttatgaatggattgaaaataacacagatgaacaggacagactaatt
aacttagtcatgaaatggtag


  DNA with Flanking Sequence

>fig|426430.8.peg.1086 Phage phi 11 orf11 protein homolog
tgctgtacttcactacagcatggtcaatcgcgggattcgcaagtatcgcaacattcatat
tctataaggaatacttttatgaagaatgaaaaaactgctacttgcgccaacaagtaacaa
taagtgttcatcaaaatatacaacttaattaaatcaaaatatacggaggtagtcaactat
ggctgaaaatattaaaacagaacaacattattacactaaagatttctcaggatacagaaa
tgaagaagataattttgtagcaaatcaagaattgacagtaacaatcacattgaacgagta
cagaaaacttattgaaataaaggctgttaaagataaagaagaagatacttacagaggtaa
gtattttgcggaagaaagaaaaaacgaaaaattggaaaaagaaaatataaaactgaaaaa
caaaatttatgaattacaaaacgaagaagataacgaggagtgcgaagaggagtacgaaga
atacaaggaggactaaaacaatgtattacaaagcgggtgacgtatgtcgaaaaatattta
atgtagatggctttgattttcaattaagagttaagaagcgagcatatagtgtcgaaatag
tcgttttagatcatgaaggaaattcaattgacgggctactagtttctgacgagaacgatc
tatacacagctttagatattttgaaacaaagtatttatgaatggattgaaaataacacag
atgaacaggacagactaattaacttagtcatgaaatggtagagggggattaactaatggc
taatctatatgagctatcagaagcatttaaagagatgtctaatcaagatgaattagatcc
aacattactaaaagatacattagattctatcaaagcagaaatgaacgtcaaagtagataa
cattgtcaattggagacgtgaaactttaggtgacatagatgtcatagataaagaaattaa
gagacttcaaaatttaaaaaaacaaaaacaaaatttaactgatcgtttaagagattactt
aaaagagatgttagaaacacaggaagtagatagttaccgcacagctactaatcatattta
caagcgcaaaaacggggctagtaaaaatattatcgatgaaaaacttattccaaaggatta
ttggctatcacaagcgccaaagcttaattctaagcaactaatcgatgatttgaaagctgg
caaagatattccgggcgctgaattaaaggtaacggaaagtttggtgattaagtgatgagt
g


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
dbj|BAF67269.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
fig|387908.2.peg.12 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Phage phi 11 orf11 protein homolog
gb|ABF73106.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gi|104641728 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|150374009 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221209 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0997
img|640795377 Staphylococcus aureus aureus Newman IMG   hypothetical protein
kegg|sae:NWMN_0997 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
ref|YP_001332031.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0997
tr|A0EWP7 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A6QFY7 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search