The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1076: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
Translate Function Assignments



Context on contig NC_009641 from base 1095617 to 1106908 (11292 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1069 1095617 1096159 543 +       2: 1 3   16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171) ## SSU rRNA m(2)G966 locus|NWMN_0987, protein_id|YP_001332021.1, gi|151221199, geneID|5330593
1070 1096161 1096643 483 + 1     9: 6 10 7 8 13 5 9 1 3   Phosphopantetheine adenylyltransferase (EC 2.7.7.3) gene_name|coaD, locus|NWMN_0988, protein_id|YP_001332022.1, gi|151221200, geneID|5330594
1071 1097844 1096705 1140 - 61     3: 2 1 12   tRNA(Met) N4-acetylcytidine(34) synthetase locus|NWMN_0989, protein_id|YP_001332023.2, gi|229577669, geneID|5330595
1072 1097971 1098528 558 + 126     1: 2   LSU rRNA accumulation protein YceD locus|NWMN_0990, protein_id|YP_001332024.1, gi|151221202, geneID|5330596
1073 1098608 1098781 174 + 79     4: 14 11 2 4   LSU ribosomal protein L32p @ LSU ribosomal protein L32p, zinc-dependent gene_name|rpmF, locus|NWMN_0991, protein_id|YP_001332025.1, gi|151221203, geneID|5330597
1074 1100283 1098898 1386 - 116         Phage DNA recombinase gene_name|int, locus|NWMN_0992, protein_id|YP_001332026.1, gi|151221204, geneID|5332394
1075 1100392 1100571 180 + 108         Phage excisionase  
1076 1101483 1100551 933 - -21         Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B] locus|NWMN_0993, protein_id|YP_001332027.1, gi|151221205, geneID|5332046
1077 1102238 1101519 720 - 35         Phage repressor protein cI locus|NWMN_0994, protein_id|YP_001332028.1, gi|151221206, geneID|5330598
1078 1102380 1102598 219 + 141         Phage transcriptional regulator cro  
1079 1102614 1103402 789 + 15         Phage antirepressor protein locus|NWMN_0995, protein_id|YP_001332029.1, gi|151221207, geneID|5330599
1080 1103419 1103613 195 + 16         Phage protein  
1081 1103666 1103842 177 + 52         Phage phi 11 orf9 protein homolog  
1082 1104047 1103817 231 - -26         Phage protein  
1083 1104097 1104234 138 + 49         hypothetical protein  
1084 1104227 1104388 162 + -8         Phage phi 11 orf10a protein homolog  
1085 1104478 1104795 318 + 89         Phage protein locus|NWMN_0996, protein_id|YP_001332030.1, gi|151221208, geneID|5330600
1086 1104800 1105060 261 + 4         Phage phi 11 orf11 protein homolog locus|NWMN_0997, protein_id|YP_001332031.1, gi|151221209, geneID|5330601
1087 1105075 1105554 480 + 14         Phage protein locus|NWMN_0998, protein_id|YP_001332032.1, gi|151221210, geneID|5330602
1088 1105554 1106327 774 + -1         Phage phi 11 orf12 protein homolog locus|NWMN_0999, protein_id|YP_001332033.1, gi|151221211, geneID|5330603
1089 1106357 1106908 552 + 29         Phage ssDNA binding protein locus|NWMN_1000, protein_id|YP_001332034.1, gi|151221212, geneID|5330604

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.8.peg.1076 Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
MEENKTLKEYLRNFLEGYKYVVENRYIYQFSSNPEAFPFMRKDDYKISIFYLNQSFFEEP
CIVVISNDSKLKEIYNFRNTDIKHLSKHFTSYIYDSKKYVEEQSGLLDFNNYIYYTSIYY
GKYIGTVIIQNNLDLFFNYGKRLANDHYNTLISKSKEKLINKAHDEIQPFNHLDLNSMKK
IVDDITFSYQIEQGLQAYKRELYLPAAATFAVAIETFLIKLKKVNKIKHKDTDSTMYTKL
LGELTKEGKVNYRTKKRVEIAYSMRNIINHSQAGAVAKGDCDFLLNTLKDIVDENERILT
EYSKSINKTE

MD5 = b3bd21da6274f878f46c777dc0ba6c13


  DNA Sequence

>fig|426430.8.peg.1076 Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
atggaagagaataaaactttaaaagaatacttgcgtaattttttagaaggttacaaatat
gtagttgaaaacagatacatttatcagtttagtagtaatccggaagccttcccattcatg
agaaaagacgattacaagatttcgatattttatctaaatcaatctttttttgaagaacct
tgcatcgttgttatctcaaatgacagtaaattaaaagaaatatataattttcgtaatact
gatatcaaacatttgtctaaacactttacttcatacatatatgattctaaaaagtatgta
gaagaacaatccggattattagattttaataactacatttattacacgtctatttactac
ggaaaatatatcgggactgtaataatacaaaacaatttagatttattttttaattatggc
aaacgattagctaacgatcattacaatacattgatatcgaagtcgaaagagaaattgata
aacaaagcacatgatgaaatacaaccgttcaaccacttagatttaaatagcatgaaaaag
attgttgatgatataactttttcttatcaaatagaacaaggattacaagcttataaaagg
gagttgtatttgccagctgcagcaacctttgctgttgctatagagacgtttttaatcaaa
ttaaaaaaagtgaataaaatcaaacataaagacaccgattcaactatgtacaccaaatta
ttaggagaattaactaaagagggtaaagtgaattatagaaccaaaaaacgggtagaaatt
gcttatagtatgagaaatataatcaaccattcacaagccggtgcagtagccaaaggtgat
tgcgacttccttttaaacacactaaaggacatcgttgatgaaaacgaaagaatattaacc
gaatacagtaaatcaattaataagacggaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1076 Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
ctcacgcctccaagacaaaaaaacgtacttaactacgcaaatgagcaattagatgaacag
aataaagtcacttctatagatgaatataaagagtctaaactagtatcgtatattgcatgt
ggtgcaactggtgctggcataggagaagaattatatgatgacatattgcatgaagaagta
ttttttaaagaagacgaaacgccatcaaatgctgatttttgtattttagttaatggtgat
tcaatggaacctatgttaaaacaaggaacatacgcttttattaagaaagaagattctatt
aaagatggtacaattgcactcgttgtattagatggagtaagtcttatcaagcgtgtagat
atatgcgaagactatattaatttggtatctctaaatccgaagtatgatgatatcaaagtc
gcttcgtttagtaatattaaagtaatgggcaaagttgtattgtgattaataacgcctatg
tggcgcgaggaggatgagggatggaagagaataaaactttaaaagaatacttgcgtaatt
ttttagaaggttacaaatatgtagttgaaaacagatacatttatcagtttagtagtaatc
cggaagccttcccattcatgagaaaagacgattacaagatttcgatattttatctaaatc
aatctttttttgaagaaccttgcatcgttgttatctcaaatgacagtaaattaaaagaaa
tatataattttcgtaatactgatatcaaacatttgtctaaacactttacttcatacatat
atgattctaaaaagtatgtagaagaacaatccggattattagattttaataactacattt
attacacgtctatttactacggaaaatatatcgggactgtaataatacaaaacaatttag
atttattttttaattatggcaaacgattagctaacgatcattacaatacattgatatcga
agtcgaaagagaaattgataaacaaagcacatgatgaaatacaaccgttcaaccacttag
atttaaatagcatgaaaaagattgttgatgatataactttttcttatcaaatagaacaag
gattacaagcttataaaagggagttgtatttgccagctgcagcaacctttgctgttgcta
tagagacgtttttaatcaaattaaaaaaagtgaataaaatcaaacataaagacaccgatt
caactatgtacaccaaattattaggagaattaactaaagagggtaaagtgaattatagaa
ccaaaaaacgggtagaaattgcttatagtatgagaaatataatcaaccattcacaagccg
gtgcagtagccaaaggtgattgcgacttccttttaaacacactaaaggacatcgttgatg
aaaacgaaagaatattaaccgaatacagtaaatcaattaataagacggaataaatagata
tccttgtattcggactctatttttaacataatttgttcataaatttttaatttaagttct
tgttcatcgtcataaatatcaaattcactactataattttcaactgattcttttatataa
gctatttctgcgtcagtaaactttacgcacatttcatcacctactttttattttattata
tcacatttagtacctagtactaaatttcgggtagcccgcctacccttattatttttttgc
caattttgaggagggagcacatgaaagtagcaatttatactagagtgagtacacttgaac
aaaaagaaaaaggacactctatcgaagaacaagaaagaaaattaagagcttacagcgaca
taaacgactggaaaattcataaagtatatactgacgctggatactccggagctaaaaaag
acagacccgctttacaagaaatgttgaatgaaatagataattttgatttggttttagtct
ataaactagatcg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT02SA0846 Staphylococcus aureus Mu50     conserved hypothetical protein
dbj|BAB57011.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF67265.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77728.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.849 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|158878.14.peg.874 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|359786.13.peg.919 Staphylococcus aureus subsp. aureus JH9 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|359786.3.peg.2171 Staphylococcus aureus subsp. aureus JH9 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|359787.11.peg.907 Staphylococcus aureus subsp. aureus JH1 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|359787.3.peg.2395 Staphylococcus aureus subsp. aureus JH1 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|387908.2.peg.3 Siphoviridae Staphylococcus aureus phage phiNM2 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|418127.4.peg.791 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|418127.6.peg.865 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|426430.6.peg.963 Staphylococcus aureus subsp. aureus str. Newman FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|505321.3.peg.2431 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553565.3.peg.650 Staphylococcus aureus A5937 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553568.3.peg.1267 Staphylococcus aureus A6224 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553571.3.peg.168 Staphylococcus aureus A6300 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553577.3.peg.1353 Staphylococcus aureus A8796 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553580.3.peg.1695 Staphylococcus aureus A8819 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553588.3.peg.1785 Staphylococcus aureus A9719 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553592.3.peg.2494 Staphylococcus aureus A9763 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553596.3.peg.1761 Staphylococcus aureus A9781 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|553601.3.peg.2630 Staphylococcus aureus A10102 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|585891.3.peg.873 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
fig|703339.3.peg.820 Staphylococcus aureus 04-02981 FIG   Hypothetical protein, SAV0849 homolog [SA bacteriophages 11, Mu50B]
gb|ABF73097.1 Staphylococcus aureus phage phiNM2     hypothetical protein
gb|ABQ48651.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0850
gb|ABR51722.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEV27166.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63442.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66817.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV79041.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV80734.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV86545.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|104641719 Staphylococcus aureus phage phiNM2 NCBI   hypothetical protein
gi|14246618 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147740353 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0850
gi|148267284 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0850
gi|149945786 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150374005 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393334 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0866
gi|151221205 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0993
gi|156721311 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979176 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0845
gi|15923839 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0849
gi|253316879 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_12184
gi|255005637 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04180
gi|257788826 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794854 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257838963 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842393 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257856123 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257857842 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257863789 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418170 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421467 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258445001 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448946 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258453924 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
img|637099363 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|639108137 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565200 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778953 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640795373 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903586 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sae:NWMN_0993 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0866 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0850 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sav:SAV0849   KEGG   hypothetical protein
kegg|saw:SAHV_0845 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371373.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0849
ref|YP_001246227.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0850
ref|YP_001316009.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0866
ref|YP_001332027.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0993
ref|YP_001441435.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0845
ref|ZP_04840092.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_12184
ref|ZP_05144238.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04180
ref|ZP_05643833.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682435.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684392.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05693318.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697055.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05701896.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A0EWN8 Staphylococcus aureus phage phiNM2 TrEMBL   Putative uncharacterized protein
tr|A5IR28 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6QFY3 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TZV4 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X038 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q932C1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search