The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.8.peg.1043: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: UPF0223 protein YktA
Translate Function Assignments



Context on contig NC_009641 from base 1065117 to 1076007 (10891 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1039 1065117 1066229 1113 +       3: 3 4 2   Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1) gene_name|phdA, locus|NWMN_0959, protein_id|YP_001331993.1, gi|151221171, geneID|5330574
1040 1066233 1067210 978 + 3     3: 3 4 2   Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1) gene_name|phdB, locus|NWMN_0960, protein_id|YP_001331994.1, gi|151221172, geneID|5332265
1041 1067301 1068593 1293 + 90     7: 3 4 9 10 6 2 7   Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12) gene_name|pdhC, locus|NWMN_0961, protein_id|YP_001331995.1, gi|151221173, geneID|5332266
1042 1068597 1070003 1407 + 3     5: 11 5 3 4 2 dlit(1756171) Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4) gene_name|pdhD, locus|NWMN_0962, protein_id|YP_001331996.1, gi|151221174, geneID|5332252
1043 1070171 1070446 276 + 167     1: 8   UPF0223 protein YktA locus|NWMN_0963, protein_id|YP_001331997.1, gi|151221175, geneID|5332253
1044 1070590 1071129 540 + 143     1: 1 dlit(24610336) Transcriptional regulator PotR locus|NWMN_0964, protein_id|YP_001331998.1, gi|151221176, geneID|5330575
1045 1071142 1072236 1095 + 12     1: 1 dlit(24610336) Spermidine/putrescine import ABC transporter, ATP-binding subunit PotA gene_name|potA, locus|NWMN_0965, protein_id|YP_001331999.1, gi|151221177, geneID|5330576
1046 1072229 1073026 798 + -8     1: 1   Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1) gene_name|potB, locus|NWMN_0966, protein_id|YP_001332000.1, gi|151221178, geneID|5332282
1047 1073032 1073841 810 + 5     1: 1 dlit(24610336) Spermidine/putrescine import ABC transporter, permease subunit PotC gene_name|potC, locus|NWMN_0967, protein_id|YP_001332001.1, gi|151221179, geneID|5332283
1048 1073841 1074914 1074 + -1     1: 1   ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1) locus|NWMN_0968, protein_id|YP_001332002.1, gi|151221180, geneID|5332284
1049 1074988 1076007 1020 + 73         FIG01108899: hypothetical protein locus|NWMN_0969, protein_id|YP_001332003.1, gi|151221181, geneID|5330577

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-1313.3.peg.147 margovan FIG006438: hypothetical protein


  Protein Sequence

>fig|426430.8.peg.1043 UPF0223 protein YktA
MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMGAYKRFKEIVPAKAEEKQIF
NTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK

MD5 = c2ba32414e58e9290f173c673da8812c


  DNA Sequence

>fig|426430.8.peg.1043 UPF0223 protein YktA
atggaatatgagtatccaattgatttagactggagtaatgaagagatgatttcagtgata
aatttctttaatcatgtagagaagtattatgaatccggcgtgacggcaggcgactttatg
ggtgcatataaaagatttaaagaaattgtgcctgctaaagcagaggaaaaacaaattttt
aatactttcgaaaaaagtagtggctataatagttacaaagcagttcaagatgtaaaaact
cactctgaagaacaaagagtaacagctaaaaaataa


  DNA with Flanking Sequence

>fig|426430.8.peg.1043 UPF0223 protein YktA
gctacagttggttattcagaagcgcaagctaaagaagaaggtttagcaattaaagcttct
aaattcccatatgcagcaaatggtcgtgcattatcattagatgatactaacggatttgtt
aaacttattacacttaaagaagatgatactttaatcggtgctcaagtagttggtactggt
gcatcagatattatctctgaattaggtttagcaattgaagctggtatgaatgctgaagat
atcgcattaacaatccatgcacatccaacattaggtgagatgactatggaagcagcagaa
aaagctatcggatacccaatccatacaatgtaataactgattatctataaagattcagtc
attaaaagctgtagcatatgctacggcttttttgttttaggtaaagtaatgtaaggaaat
tgatttgagatatcgttaacatgtgacatgcatgttatactagcgatgctaacaaaagaa
ttgaaatggagggttcaacaatggaatatgagtatccaattgatttagactggagtaatg
aagagatgatttcagtgataaatttctttaatcatgtagagaagtattatgaatccggcg
tgacggcaggcgactttatgggtgcatataaaagatttaaagaaattgtgcctgctaaag
cagaggaaaaacaaatttttaatactttcgaaaaaagtagtggctataatagttacaaag
cagttcaagatgtaaaaactcactctgaagaacaaagagtaacagctaaaaaataattcg
ttcgaaattaacacaatttaataggaatttttctttaaaactattgctaataaagctata
ttttgatacctttatcaagtgttaaacaaaatgtttgataaaagtaaacttaatatagct
tttttaggtggaaaaataaatgaacataggtaataaaattaaaaatcttagaagaattaa
aaatttaacgcaagaagaacttgctgaacgtacagacttatcgaaaggctacatttcaca
aatagaaagtgaacatgcctcaccaagtatggaaactttcttaaatattatagaggtgtt
aggaacgacgccaagtgaattttttaaagacagtgaaaatgaaaaagtattatacaagaa
ggaagaacaagttatttatgatgagtatgatgaaggttatatattaaattggttagtttc
aaagtcaaatgaatatgatatggagccattaatattaactttaaagcctggagcatcata
taaaaattttaatcca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA1031 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA1086 Staphylococcus aureus Mu50     Uncharacterised protein family (UPF0223) superfamily
cmr|NT03SA1069 Staphylococcus aureus MW2     conserved hypothetical protein
cmr|NT05SA0943 Staphylococcus aureus NCTC 8325     protein //
cmr|NT09SA1028 Staphylococcus aureus subsp. aureus MSSA476     Hypothetical UPF0223 protein SAV1097/SA0947/MW0980
cmr|SACOL1106 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0997 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB42193.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57259.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAB94845.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67235.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77972.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
emb|CAG42806.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   conserved hypothetical protein
fig|158878.1.peg.1097 Staphylococcus aureus subsp. aureus Mu50 FIG   UPF0223 protein YktA
fig|158878.14.peg.1125 Staphylococcus aureus subsp. aureus Mu50 FIG   UPF0223 protein YktA
fig|158879.1.peg.977 Staphylococcus aureus subsp. aureus N315 FIG   UPF0223 protein YktA
fig|158879.11.peg.1013 Staphylococcus aureus subsp. aureus N315 FIG   UPF0223 protein YktA
fig|196620.1.peg.980 Staphylococcus aureus subsp. aureus MW2 FIG   UPF0223 protein YktA
fig|196620.5.peg.1029 Staphylococcus aureus subsp. aureus MW2 FIG   UPF0223 protein YktA
fig|282459.1.peg.1023 Staphylococcus aureus subsp. aureus MSSA476 FIG   UPF0223 protein YktA
fig|282459.5.peg.1071 Staphylococcus aureus subsp. aureus MSSA476 FIG   UPF0223 protein YktA
fig|359786.13.peg.1230 Staphylococcus aureus subsp. aureus JH9 FIG   UPF0223 protein YktA
fig|359786.3.peg.2394 Staphylococcus aureus subsp. aureus JH9 FIG   UPF0223 protein YktA
fig|367830.3.peg.1874 Staphylococcus aureus subsp. aureus USA300 FIG   UPF0223 protein YktA
fig|418127.4.peg.1004 Staphylococcus aureus subsp. aureus Mu3 FIG   UPF0223 protein YktA
fig|426430.6.peg.933 Staphylococcus aureus subsp. aureus str. Newman FIG   UPF0223 protein YktA
fig|451515.3.peg.1095 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   UPF0223 protein YktA
fig|451516.9.peg.1099 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   UPF0223 protein YktA
fig|452948.4.peg.1365 Staphylococcus aureus 930918-3 FIG   UPF0223 protein YktA
fig|455227.3.peg.651 Staphylococcus aureus D30 FIG   UPF0223 protein YktA
fig|505321.3.peg.1882 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   UPF0223 protein YktA
fig|546342.3.peg.1740 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   UPF0223 protein YktA
fig|546343.3.peg.518 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   UPF0223 protein YktA
fig|548474.3.peg.1218 Staphylococcus aureus subsp. aureus TCH130 FIG   UPF0223 protein YktA
fig|548475.3.peg.1328 Staphylococcus aureus subsp. aureus TCH70 FIG   UPF0223 protein YktA
fig|553567.3.peg.1449 Staphylococcus aureus A5948 FIG   UPF0223 protein YktA
fig|553568.3.peg.2192 Staphylococcus aureus A6224 FIG   UPF0223 protein YktA
fig|553571.3.peg.135 Staphylococcus aureus A6300 FIG   UPF0223 protein YktA
fig|553573.3.peg.1144 Staphylococcus aureus A8115 FIG   UPF0223 protein YktA
fig|553574.3.peg.1460 Staphylococcus aureus A8117 FIG   UPF0223 protein YktA
fig|553577.3.peg.2418 Staphylococcus aureus A8796 FIG   UPF0223 protein YktA
fig|553580.3.peg.1045 Staphylococcus aureus A8819 FIG   UPF0223 protein YktA
fig|553581.3.peg.1180 Staphylococcus aureus A9299 FIG   UPF0223 protein YktA
fig|553588.3.peg.2119 Staphylococcus aureus A9719 FIG   UPF0223 protein YktA
fig|553590.4.peg.143 Staphylococcus aureus A9754 FIG   UPF0223 protein YktA
fig|553592.3.peg.246 Staphylococcus aureus A9763 FIG   UPF0223 protein YktA
fig|553594.3.peg.2133 Staphylococcus aureus A9765 FIG   UPF0223 protein YktA
fig|553601.3.peg.2044 Staphylococcus aureus A10102 FIG   UPF0223 protein YktA
fig|585891.3.peg.1122 Staphylococcus aureus subsp. aureus Mu50-omega FIG   UPF0223 protein YktA
fig|644279.4.peg.1104 Staphylococcus aureus subsp. aureus 132 FIG   UPF0223 protein YktA
fig|680649.3.peg.1857 Staphylococcus aureus subsp. aureus MR1 FIG   UPF0223 protein YktA
fig|681288.4.peg.1067 Staphylococcus aureus subsp. aureus ED98 FIG   UPF0223 protein YktA
fig|703339.3.peg.1067 Staphylococcus aureus 04-02981 FIG   UPF0223 protein YktA
fig|762962.3.peg.968 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   UPF0223 protein YktA
fig|93061.3.peg.1002 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   UPF0223 protein YktA
fig|93061.5.peg.959 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   UPF0223 protein YktA
fig|93062.4.peg.1376 Staphylococcus aureus subsp. aureus COL FIG   UPF0223 protein YktA
gb|AAW37986.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD21757.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD30164.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48957.1 Staphylococcus aureus subsp. aureus JH9     protein of unknown function UPF0223
gb|ABR52033.1 Staphylococcus aureus subsp. aureus JH1     protein of unknown function UPF0223
gb|ABX29060.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical protein USA300HOU_1040
gb|EEV27484.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65719.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66550.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV72827.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV75387.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV79008.1 Staphylococcus aureus A6300     hypothetical protein SAIG_02315
gb|EEV79680.1 Staphylococcus aureus A6224     hypothetical protein SAHG_00651
gb|EEV83003.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44914.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0896
gb|EEW47699.1 Staphylococcus aureus D30     hypothetical protein SAD30_1513
gi|122540569 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SAOUHSC_01044
gi|123486424 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SAUSA300_0997
gi|13700897 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246867 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740659 Staphylococcus aureus subsp. aureus JH9 NCBI   protein of unknown function UPF0223
gi|148267590 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1157
gi|149946097 Staphylococcus aureus subsp. aureus JH1 NCBI   protein of unknown function UPF0223
gi|150373975 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393645 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1179
gi|151221175 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0963
gi|156721555 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979420 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1089
gi|15924087 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1097
gi|15926682 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0947
gi|160368089 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1040
gi|161509280 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_1040
gi|166977883 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SAHV_1089
gi|189038549 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein USA300HOU_1040
gi|189038618 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SaurJH1_1179
gi|189038753 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SaurJH9_1157
gi|205830123 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein NWMN_0963
gi|21204147 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282709 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0980
gi|221138708 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_08710
gi|221140503 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_02571
gi|253316350 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09451
gi|255005884 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_05425
gi|257789144 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795172 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257841274 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842122 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257848842 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257851448 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257856090 Staphylococcus aureus A6300 NCBI   hypothetical protein SAIG_02315
gi|257856777 Staphylococcus aureus A6224 NCBI   hypothetical protein SAHG_00651
gi|257860171 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258407119 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421789 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258436153 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258443358 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258444968 Staphylococcus aureus A6300 NCBI   hypothetical protein SAIG_02315
gi|258449857 Staphylococcus aureus A6224 NCBI   hypothetical protein SAHG_00651
gi|258451956 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159876 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0896
gi|259163139 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1513
gi|49244378 Staphylococcus aureus subsp. aureus MSSA476 NCBI   conserved hypothetical protein
gi|49485935 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1032
gi|54040022 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SA0947
gi|54040023 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein MW0980
gi|54042729 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SAV1097
gi|57285892 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651706 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1106
gi|81649511 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SAS1032
gi|81694753 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0223 protein SACOL1106
gi|87127243 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87161269 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0997
gi|87202354 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194796 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_01044
img|637092596 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099610 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637151869 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157259 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298743 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887649 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893686 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640565508 Staphylococcus aureus aureus JH9 IMG   protein of unknown function UPF0223
img|640779266 Staphylococcus aureus aureus JH1 IMG   protein of unknown function UPF0223
img|640795343 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903832 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641309010 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical protein
img|641770815 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0997 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1106 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0963 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_1179 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1157 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0980 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01044 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS1032   KEGG   hypothetical protein
kegg|sau:SA0947   KEGG   hypothetical protein
kegg|sav:SAV1097   KEGG   hypothetical protein
kegg|saw:SAHV_1089 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_1040 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_371621.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1097
ref|NP_374215.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0947
ref|NP_645797.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0980
ref|YP_001246533.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1157
ref|YP_001316320.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1179
ref|YP_001331997.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0963
ref|YP_001441679.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1089
ref|YP_001574939.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_1040
ref|YP_043156.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1032
ref|YP_185970.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1106
ref|YP_493695.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0997
ref|YP_499593.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_01044
ref|ZP_03563510.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_08710
ref|ZP_03564996.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_02571
ref|ZP_04839563.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09451
ref|ZP_05144485.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_05425
ref|ZP_05644151.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680268.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684710.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05689136.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05691701.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05693285.1 Staphylococcus aureus A6300 RefSeq   hypothetical protein SAIG_02315
ref|ZP_05697955.1 Staphylococcus aureus A6224 RefSeq   hypothetical protein SAHG_00651
ref|ZP_05699972.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
sp|A5IRY4 Staphylococcus aureus (strain JH9) SwissProt   RecName: Full=UPF0223 protein SaurJH9_1157
sp|A6QFV3 Staphylococcus aureus (strain Newman) SwissProt   RecName: Full=UPF0223 protein NWMN_0963
sp|A6U0R5 Staphylococcus aureus (strain JH1) SwissProt   RecName: Full=UPF0223 protein SaurJH1_1179
sp|A7X0Z9 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=UPF0223 protein SAHV_1089
sp|A8Z1N7 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   RecName: Full=UPF0223 protein USA300HOU_1040
sp|P67358 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=UPF0223 protein SAV1097
sp|P67359 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=UPF0223 protein SA0947
sp|P67360 Staphylococcus aureus (strain MW2) SwissProt   RecName: Full=UPF0223 protein MW0980
sp|Q2FHY3 Staphylococcus aureus (strain USA300) SwissProt   RecName: Full=UPF0223 protein SAUSA300_0997
sp|Q2G2A2 Staphylococcus aureus (strain NCTC 8325) SwissProt   RecName: Full=UPF0223 protein SAOUHSC_01044
sp|Q5HGY7 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=UPF0223 protein SACOL1106
sp|Q6GAB7 Staphylococcus aureus (strain MSSA476) SwissProt   RecName: Full=UPF0223 protein SAS1032
sp|Y1032_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SAS1032
sp|Y1040_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein USA300HOU_1040
sp|Y1044_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SAOUHSC_01044
sp|Y1089_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SAHV_1089
sp|Y1097_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SAV1097
sp|Y1106_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SACOL1106
sp|Y1157_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SaurJH9_1157
sp|Y1179_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SaurJH1_1179
sp|Y947_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SA0947
sp|Y963_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein NWMN_0963
sp|Y980_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein MW0980
sp|Y997_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0223 protein SAUSA300_0997


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search