The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|426430.6.peg.889: Staphylococcus aureus subsp. aureus str. Newman

This feature in The SEED Viewer

NCBI Taxonomy Id: 426430

Current Assignment: membrane protein, putative
Translate Function Assignments



Context on contig NC_009641 from base 1013499 to 1025298 (11800 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
885 1013499 1014320 822 +       3: 11 7 3 ff
icw(3)
isu
dlit(
20643650)
Naphthoate synthase (EC 4.1.3.36) memB, NWMN_0915, YP_001331949.1, gi|151221127, GeneID:5330553
886 1016107 1014926 1182 - 605       ff Staphopain B precursor (EC 3.4.22.-) sspB, NWMN_0917, YP_001331951.1, gi|151221129, GeneID:5332511
887 1017199 1016189 1011 - 81     1: 2 ff
ilit(
11767947)
ilit(12127798)
ilit(14747701)
ilit(3306605)
ilit(96922)
isu
dlit(96922)
dlit(3306605)
Glutamyl endopeptidase precursor (EC 3.4.21.19), serine proteinase SspA sspA, NWMN_0918, YP_001331952.1, gi|151221130, GeneID:5332509
888 1018881 1017727 1155 - 527     1: 4 ff
isu
isu
N-acetyl-L,L-diaminopimelate aminotransferase (EC 2.6.1.-) NWMN_0919, YP_001331953.1, gi|151221131, GeneID:5332508
889 1020087 1019077 1011 - 195       ff membrane protein, putative NWMN_0920, YP_001331954.1, gi|151221132, GeneID:5330554
890 1020686 1020796 111 + 598         hypothetical protein  
891 1024636 1020866 3771 - 69     5: 6 9 10 5 1 ff
ilit(
7816834)
isu
isu
isu
Phage lysin, N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) atl, NWMN_0922, YP_001331956.1, gi|151221134, GeneID:5330556
892 1025298 1024864 435 - 227     1: 8 ff GNAT family acetyltransferase YjcF NWMN_0923, YP_001331957.1, gi|151221135, GeneID:5331762

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|426430.6.peg.889 membrane protein, putative
MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS

MD5 = df9b7052c6dd311eb2d87fc2c33be882


  DNA Sequence

>fig|426430.6.peg.889 membrane protein, putative
atgacttcattaaaagagagagattatttttttgacaacgcaagagcaattttaatatta
ttagtcgtatttggacatatgttacaaccctacactagtggcgataaatatttatcagca
ttatacctagttatttatagtttccatatgccaacatttttgtttatatctggttatttc
gcgaaaaatattgataaaccatactatttagaaaaaatttcaaaacgtttgatagtacct
tatatgatattttttgcattcttttcaatttattatttcttaacaggtaaaagtgacgaa
ttacaacttgatccttttaacccagtatttgcgttatggtttttgatcacgctatttttc
tttcatgtcattttagtaatagttagaagatttaatccatataaagtgctatcagtttca
attattatatctattggagcaggtttttcagataacatcgatagctacttaagcatttca
aggacaatcgtatttttcccaatattttatctaggttacattttcaccaaaaaacatacg
gctatttttaaaaataaaaaactaataccagtatctatcattacctttattttgtttttt
atcgtttacgtgattcatcctatcaatgcagattggttattgggaagttcaccatatact
tcacttgaaaatgaaggacagagtatattcagtccttttaaacgacttatattatatgga
attatattaatcgcaatgactgcgtttctaaatttaatgtcaacaaagaaaaaattatat
acttatattggtagtcgtacgctatacgtatatttattacatggtttaattattggcatt
gttagaggatttgaatggtacccattcgataatcctatatcattaatgacttatctttat
ttaataagtatatctgtaatcatcgtatatgtattatctacaaactttgtttgtaaatgg
acaaatccaataattaatttacaaagaccatcacagtttaaagattcataa


  DNA with Flanking Sequence

>fig|426430.6.peg.889 membrane protein, putative
acattgacatcttgcttcaatcaattcgcaacgtgcattatttatttgtgaaattaatgt
acgtgcttgatcagtcaaaattaattctttacatcttaaatcttcgctagattgttgact
tgtgatgtaccctttcaaaactaatttcttaatccaccttgaaactatagattgttccct
gctaatcttcatcgtcaaatcatactgtgataagcgatcgtaattaaataaaatacggag
aagttctagctgttcagatgtgatatccgtgcgttgtccaaatcttctattcactaagtt
taagtcattgttagtcagtgtaataagtttttcaagttgtttatacatgttgttctactc
cactacatattatttataatattatatgctttttttataatttttacaatactattcgac
acaatagacaaatttgttgcataactaatacaaaatataataaattagtaagagtcttat
ggacataaaggagataaaatatgacttcattaaaagagagagattatttttttgacaacg
caagagcaattttaatattattagtcgtatttggacatatgttacaaccctacactagtg
gcgataaatatttatcagcattatacctagttatttatagtttccatatgccaacatttt
tgtttatatctggttatttcgcgaaaaatattgataaaccatactatttagaaaaaattt
caaaacgtttgatagtaccttatatgatattttttgcattcttttcaatttattatttct
taacaggtaaaagtgacgaattacaacttgatccttttaacccagtatttgcgttatggt
ttttgatcacgctatttttctttcatgtcattttagtaatagttagaagatttaatccat
ataaagtgctatcagtttcaattattatatctattggagcaggtttttcagataacatcg
atagctacttaagcatttcaaggacaatcgtatttttcccaatattttatctaggttaca
ttttcaccaaaaaacatacggctatttttaaaaataaaaaactaataccagtatctatca
ttacctttattttgttttttatcgtttacgtgattcatcctatcaatgcagattggttat
tgggaagttcaccatatacttcacttgaaaatgaaggacagagtatattcagtcctttta
aacgacttatattatatggaattatattaatcgcaatgactgcgtttctaaatttaatgt
caacaaagaaaaaattatatacttatattggtagtcgtacgctatacgtatatttattac
atggtttaattattggcattgttagaggatttgaatggtacccattcgataatcctatat
cattaatgacttatctttatttaataagtatatctgtaatcatcgtatatgtattatcta
caaactttgtttgtaaatggacaaatccaataattaatttacaaagaccatcacagttta
aagattcataattttatactgtctaagtacattaactgtaaccactttattcattttgaa
aagtagttactacagtgtatttagacatttttcgtttttcaaataaagcttaagtaattt
acccttttttgctttaaaagtatgttatgatattattaatttctaaatttttagacaata
tttgatttatatttgaggtgtcacaaatgaaactttctttaaattctaattctaaatatt
taagagcaccaagtattcgccaattttcaaatcgtatgaataatttggatgattgtgtta
atttaactattggccaaccagacttcccgatgcctgatgttgtgaaaaaggcatatattg
atgctattaacaatgacaagacatcatactctcacaataaagggttattagaaactcgcg
aagcaattagtcaatacttcaaaaatcgttatcatttttcctatgatcctgaagaaatta
ttgtgacaaatggagcaagtgaagcaataga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0016020       C:membrane
GO:0016747       F:transferase activity, transferring acyl gro...
cmr|NT03SA1018 Staphylococcus aureus MW2     membrane protein, putative
cmr|NT05SA0898 Staphylococcus aureus NCTC 8325     acyltransferase 3
cmr|NT09SA0982 Staphylococcus aureus subsp. aureus MSSA476     B. subtilis YkrP protein homolog lmo0995
cmr|SACOL1059 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0953 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative membrane protein
dbj|BAB94799.1 Staphylococcus aureus subsp. aureus MW2     conserved hypothetical protein
dbj|BAF67192.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
emb|CAG42761.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|196620.1.peg.934 Staphylococcus aureus subsp. aureus MW2 FIG   membrane protein, putative
fig|196620.5.peg.979 Staphylococcus aureus subsp. aureus MW2 FIG   membrane protein, putative
fig|282459.1.peg.978 Staphylococcus aureus subsp. aureus MSSA476 FIG   membrane protein, putative
fig|282459.5.peg.1021 Staphylococcus aureus subsp. aureus MSSA476 FIG   membrane protein, putative
fig|367830.3.peg.1518 Staphylococcus aureus subsp. aureus USA300 FIG   membrane protein, putative
fig|426430.8.peg.994 Staphylococcus aureus subsp. aureus str. Newman FIG   membrane protein, putative
fig|451515.3.peg.1046 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   membrane protein, putative
fig|451516.9.peg.1050 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   membrane protein, putative
fig|452948.4.peg.2062 Staphylococcus aureus 930918-3 FIG   membrane protein, putative
fig|546342.3.peg.1020 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   membrane protein, putative
fig|546343.3.peg.1887 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   membrane protein, putative
fig|548475.3.peg.1281 Staphylococcus aureus subsp. aureus TCH70 FIG   membrane protein, putative
fig|553567.3.peg.1499 Staphylococcus aureus A5948 FIG   membrane protein, putative
fig|553590.4.peg.94 Staphylococcus aureus A9754 FIG   membrane protein, putative
fig|553594.3.peg.2033 Staphylococcus aureus A9765 FIG   membrane protein, putative
fig|644279.4.peg.1055 Staphylococcus aureus subsp. aureus 132 FIG   membrane protein, putative
fig|762962.3.peg.1018 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   membrane protein, putative
fig|93061.3.peg.952 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   membrane protein, putative
fig|93061.5.peg.910 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   membrane protein, putative
fig|93062.19.peg.1030 Staphylococcus aureus subsp. aureus COL FIG   membrane protein, putative
fig|93062.4.peg.1228 Staphylococcus aureus subsp. aureus COL FIG   membrane protein, putative
gb|AAW36524.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD20498.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative membrane protein
gb|ABD30115.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|EES55296.1 Staphylococcus aureus subsp. aureus TCH70     possible acetyltransferase
gb|EEV83047.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEW44336.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1108
gi|150373932 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|151221132 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0920
gi|21204101 Staphylococcus aureus subsp. aureus MW2 NCBI   conserved hypothetical protein
gi|21282663 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0934
gi|221138028 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_05148
gi|221141834 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_09416
gi|251802639 Staphylococcus aureus subsp. aureus TCH70 NCBI   possible acetyltransferase
gi|251813949 Staphylococcus aureus subsp. aureus TCH70 NCBI   possible acetyltransferase
gi|257860215 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258452000 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|259159278 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1108
gi|49244333 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49485890 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0986
gi|57284430 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57650244 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL1059
gi|87125984 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative membrane protein
gi|87160010 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0953
gi|87202305 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194747 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00991
img|637151823 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637157214 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298697 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887605 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637893636 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|640795300 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|641772573 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical protein
kegg|saa:SAUSA300_0953 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL1059 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0920 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sam:MW0934 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00991 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0986   KEGG   hypothetical protein
ref|NP_645751.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0934
ref|YP_001331954.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0920
ref|YP_043111.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0986
ref|YP_185924.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL1059
ref|YP_493651.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0953
ref|YP_499543.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00991
ref|ZP_03562830.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_05148
ref|ZP_03566327.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_09416
ref|ZP_04828422.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   possible acetyltransferase
ref|ZP_05700016.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
tr|A6QFR0 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|C5QI06 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Possible acetyltransferase
tr|Q2FI27 Staphylococcus aureus (strain USA300) TrEMBL   Putative membrane protein
tr|Q2FZL0 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HH33 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q6GAG2 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q8NX97 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0934


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
PSORT::CytoplasmicMembrane 9.99
PSORT_score::CytoplasmicMembrane 9.99
similar_to_human no


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search