The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|411474.6.peg.1490: Coprococcus eutactus ATCC 27759

This feature in The SEED Viewer

NCBI Taxonomy Id: 411474

Current Assignment: Cysteine synthase (EC 2.5.1.47)
Translate Function Assignments



Context on contig NZ_DS483532 from base 249798 to 261925 (12128 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1485 251576 249798 1779 -       6: 19 16 20 15 6 21   Adenylylsulfate reductase alpha-subunit (EC 1.8.99.2) locus|COPEUT_00628, protein_id|ZP_02205866.1, gi|163814477, InterPro:IPR004112, InterPro:IPR013027
1486 252663 251602 1062 - 25     4: 7 1 2 3   Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) locus|COPEUT_00629, protein_id|ZP_02205867.1, gi|163814478, InterPro:IPR003439, InterPro:IPR003593, InterPro:IPR005666, InterPro:IPR008995, InterPro:IPR013611
1487 253691 252819 873 - 155     3: 1 2 3   Sulfate transport system permease protein CysW locus|COPEUT_00630, protein_id|ZP_02205868.1, gi|163814479, InterPro:IPR000515, InterPro:IPR005667
1488 254578 253709 870 - 17     3: 1 2 3   Sulfate transport system permease protein CysT locus|COPEUT_00631, protein_id|ZP_02205869.1, gi|163814480, InterPro:IPR000515, InterPro:IPR005667, InterPro:IPR011865
1489 255607 254597 1011 - 18     2: 1 2   Sulfate and thiosulfate binding protein CysP locus|COPEUT_00632, protein_id|ZP_02205870.1, gi|163814481, InterPro:IPR005669, InterPro:IPR006059
1490 256553 255621 933 - 13     13: 17 10 5 14 18 12 8 22 9 1 2 3 13   Cysteine synthase (EC 2.5.1.47) locus|COPEUT_00633, protein_id|ZP_02205871.1, gi|163814482, InterPro:IPR001926, InterPro:IPR005856, InterPro:IPR005859
1491 257285 256662 624 - 108         hypothetical protein locus|COPEUT_00634, protein_id|ZP_02205872.1, gi|163814483, InterPro:IPR001087, InterPro:IPR013830, InterPro:IPR013831
1492 259309 257612 1698 - 326         hypothetical protein locus|COPEUT_00635, protein_id|ZP_02205873.1, gi|163814484, InterPro:IPR012547
1493 260163 259453 711 - 143     1: 4   DNA-binding response regulator KdpE locus|COPEUT_00636, protein_id|ZP_02205874.1, gi|163814485, InterPro:IPR001789, InterPro:IPR001867, InterPro:IPR011006, InterPro:IPR011991
1494 260857 260153 705 - -11     2: 11 4   Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-) locus|COPEUT_00637, protein_id|ZP_02205875.1, gi|163814486, InterPro:IPR003594, InterPro:IPR003661, InterPro:IPR009082
1495 261245 261373 129 + 387         hypothetical protein  
1496 261925 261485 441 - 111         Putative iron-sulfur cluster assembly scaffold protein for SUF system, SufE2 locus|COPEUT_00638, protein_id|ZP_02205876.1, gi|163814487, InterPro:IPR002871, InterPro:IPR011341

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Cysteine_Biosynthesis OlgaZ Cysteine synthase (EC 2.5.1.47)
Experimental_Sulfur_transfer_Archaea vcrecy Cysteine synthase (EC 2.5.1.47)
Cysteine_Biosynthesis,_MCB_432 gjo Cysteine synthase (EC 2.5.1.47)
CLO_Cysteine Lerma-Ortiz_Claudia_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_Cysteine_phenotype Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
dcernst_RidA_proteins Ernst_Dustin_user Cysteine synthase (EC 2.5.1.47)
Methionine_Biosynthesis rodionov Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_HGM_2 Ravcheev_Dmitry_user Cysteine synthase (EC 2.5.1.47)
Proline Cysteine synthase (EC 2.5.1.47)
Fermentation_of_amino_acids_HGM_2 Cysteine synthase (EC 2.5.1.47)
test_aaFermentation Cysteine synthase (EC 2.5.1.47)
Cysteine_biosynthesis_PanGenomes Acharya_Geeta_user Cysteine synthase (EC 2.5.1.47)


  Protein Sequence

>fig|411474.6.peg.1490 Cysteine synthase (EC 2.5.1.47)
MAKIASQLTELIGNTPLLELTNYEKELGLKAHIVAKLEYFNPLGSVKDRVAAAMIEQGIR
DGLINQDTVIIEPTSGNTGIGLAFVSAAKGLHLILTMPDTMSVERRKIVSALGAEIVLTP
GREGMKGAIAKANELKEQYGNAFIPQQFENKANPAIHKKTTAEEIWRDTDGKVDAFVSAV
GTGGTATGTGSGLKEHNPKVKLIAVEPADSPVLSGGAPGPHKIQGIGAGFIPGVMDLSIV
DEIIRIQNDDAFDTARKIAKTDGVLVGISAGAALYAATELAKRPEYEGKTIVVLFPDTGE
RYLSTSLFNL

MD5 = 56dac4666130f0cfc833262cf14bfe75


  DNA Sequence

>fig|411474.6.peg.1490 Cysteine synthase (EC 2.5.1.47)
atggcaaagatagcatcacagttgacagaacttataggaaacactccacttctggagctt
acaaattacgagaaggagcttggacttaaggcgcacatcgttgcaaagcttgagtacttc
aatccacttggatcagtgaaggatcgtgtggcagcagccatgatcgagcagggaatcagg
gatggcctcatcaatcaggatacagtcatcatcgagcctacatcaggaaatacgggaatc
ggacttgcatttgtatcagcggcaaagggacttcacctgatactcaccatgccggacacc
atgagcgttgagcgcagaaagatagtgtcagctctcggcgctgagattgtgttaacacct
ggcagagagggaatgaagggagccattgccaaggcaaatgagctcaaggagcagtacgga
aatgcgtttatcccacagcagtttgagaacaaggcaaatcctgctatccacaagaagaca
acagcagaggagatctggagagatacagacggaaaggttgatgcatttgtatcagcagta
ggaacaggcggaacagccacaggaacaggaagcggactcaaggagcacaacccgaaggtt
aagctgattgcagttgagcctgctgattcaccggttctctcaggtggtgcacccggacca
cacaagatacagggaatcggagccggattcatacctggagttatggatctgagcatcgtg
gacgagatcatcaggatccagaacgatgacgcatttgacacagcaagaaagattgcaaag
acagatggtgttctggttggaatatccgcaggtgcggcactctatgcggcaactgagctt
gcaaagagacctgagtacgagggcaagaccatcgtggtcctcttccctgacacaggagag
agatacctctcaacatcactgtttaacctgtaa


  DNA with Flanking Sequence

>fig|411474.6.peg.1490 Cysteine synthase (EC 2.5.1.47)
aaccggagaatatagtgatcatgcttggaacaaatgactgtaagacagtgttctcggcat
caccggatgttataggcaagggaatacggagactgctcattcaggcaaagcagtattcag
cggacagcaggatacttctcgtatcgccgatacatttgggcgagcaggtgtggaaggatg
aatttgatcctgagttctcaccggaatccgttgaggtgtcaagaaaactcacagatgtgt
acaggaagatagccgatgagttcggcgtggaattcctggcggcatcatccgtggcggaca
gcagcgaggcagatcaggagcatatgaatcctgaaggtcacgcggcactggcgggagcga
tagaggaaaagatttatcagatggcctgttaagaattatatagaaaataatgcacagtat
ataaagatggttgagaatcaagaaataatatagagacttgaaaaagtaaaaaagaaaaga
aaagaaaggaaacaagaaccatggcaaagatagcatcacagttgacagaacttataggaa
acactccacttctggagcttacaaattacgagaaggagcttggacttaaggcgcacatcg
ttgcaaagcttgagtacttcaatccacttggatcagtgaaggatcgtgtggcagcagcca
tgatcgagcagggaatcagggatggcctcatcaatcaggatacagtcatcatcgagccta
catcaggaaatacgggaatcggacttgcatttgtatcagcggcaaagggacttcacctga
tactcaccatgccggacaccatgagcgttgagcgcagaaagatagtgtcagctctcggcg
ctgagattgtgttaacacctggcagagagggaatgaagggagccattgccaaggcaaatg
agctcaaggagcagtacggaaatgcgtttatcccacagcagtttgagaacaaggcaaatc
ctgctatccacaagaagacaacagcagaggagatctggagagatacagacggaaaggttg
atgcatttgtatcagcagtaggaacaggcggaacagccacaggaacaggaagcggactca
aggagcacaacccgaaggttaagctgattgcagttgagcctgctgattcaccggttctct
caggtggtgcacccggaccacacaagatacagggaatcggagccggattcatacctggag
ttatggatctgagcatcgtggacgagatcatcaggatccagaacgatgacgcatttgaca
cagcaagaaagattgcaaagacagatggtgttctggttggaatatccgcaggtgcggcac
tctatgcggcaactgagcttgcaaagagacctgagtacgagggcaagaccatcgtggtcc
tcttccctgacacaggagagagatacctctcaacatcactgtttaacctgtaattaggag
aaaaatatgagacttgggaaaagagtattgcttctgtccatggcggcggtgcttgcgata
ggcgcggccggctgtggcggtaagaaggacgatgttatcacaattacaaatgtttcgtat
gacccaacgagggagctgtatgagcgatacaatgacatgttcgaacagtattataaggag
cagtacggacaggacatcaagatcatccagtctcatggaggctccggctcacaggcgaga
tcggttgtggagggctgtaatgcagatgttgtcacactggcacttgagcatgacattgac
ctcatatcggaaaatggtctgatagataagggctggatagatgaatttggcaaggattcg
gcgccgtacacatccacgatcgtctttctggttagaaagggaaatgacaagaacatacag
gactggaacgatctggtgaaggacgatgtggaagtcataacacctgatccgaagagcagc
ggtggtgcctgct


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004124       F:cysteine synthase activity
GO:0006535       P:cysteine biosynthetic process from serine
GO:0030170       F:pyridoxal phosphate binding
gb|EDP27112.1 Coprococcus eutactus ATCC 27759     hypothetical protein COPEUT_00633
gi|158450117 Coprococcus eutactus ATCC 27759 NCBI   hypothetical protein COPEUT_00633
gi|163814482 Coprococcus eutactus ATCC 27759 NCBI   hypothetical protein COPEUT_00633
img|641413412 Coprococcus eutactus ATCC 27759 IMG   hypothetical protein( EC:2.5.1.47 )
ref|ZP_02205871.1 Coprococcus eutactus ATCC 27759 RefSeq   hypothetical protein COPEUT_00633
tr|A8SQY9 Coprococcus eutactus ATCC 27759 TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search