The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|349106.5.peg.813: Psychrobacter sp. PRwf-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 349106

Current Assignment: Tryptophan synthase beta chain (EC 4.2.1.20)
Translate Function Assignments



Context on contig NC_009524 from base 894418 to 906819 (12402 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
809 896148 894418 1731 -       2: 16 14 ff
ilit(
10922054)
ilit(10970866)
ilit(11408489)
ilit(12013438)
ilit(12033945)
ilit(12578991)
ilit(16226256)
isu
isu
Prolyl-tRNA synthetase (EC 6.1.1.15), bacterial type PsycPRwf_0751, YP_001279653.1, gi|148652560, InterPro:IPR002314, InterPro:IPR002316, InterPro:IPR004154, InterPro:IPR004500, InterPro:IPR006195, InterPro:IPR007214, GeneID:5206159
810 896651 897385 735 + 502       ff FIG00968644: hypothetical protein PsycPRwf_0752, YP_001279654.1, gi|148652561, GeneID:5205739
811 899057 897405 1653 - 19     7: 22 13 10 12 21 20 19 ff
ilit(
10896222)
ilit(11254140)
ilit(12835419)
ilit(15213381)
ilit(15576622)
ilit(15721603)
ilit(1833725)
ilit(2110564)
ilit(2200511)
ilit(2837735)
ilit(3316199)
ilit(6325460)
ilit(7604260)
ilit(8344951)
ilit(9360600)
ilit(9801304)
isu
isu
Deoxyribodipyrimidine photolyase (EC 4.1.99.3) PsycPRwf_0753, YP_001279655.1, gi|148652562, InterPro:IPR002081, InterPro:IPR005101, InterPro:IPR006050, InterPro:IPR006051, GeneID:5205740
812 899339 899998 660 + 281 21 6: 1 2 6 3 5 4 ff
icw(2)
icw(2)
ilit(
10511537)
ilit(10628865)
ilit(1400208)
ilit(2828322)
ilit(9166771)
isu
isu
Phosphoribosylanthranilate isomerase (EC 5.3.1.24) PsycPRwf_0754, YP_001279656.1, gi|148652563, InterPro:IPR001240, GeneID:5205741
813 900114 901373 1260 + 115   5: 1 2 3 7 4 ff
icw(2)
icw(2)
ilit(
10361288)
ilit(10628865)
ilit(1773058)
ilit(2211532)
ilit(2299982)
ilit(2828322)
ilit(8159786)
ilit(8581158)
ilit(9097426)
isu
isu
Tryptophan synthase beta chain (EC 4.2.1.20) PsycPRwf_0755, YP_001279657.1, gi|148652564, InterPro:IPR001926, InterPro:IPR006653, InterPro:IPR006654, GeneID:5205742
814 901445 902272 828 + 71 34 5: 1 2 3 7 4 ff
icw(2)
icw(2)
ilit(
10361288)
ilit(10511537)
ilit(10628865)
ilit(1400208)
ilit(1773058)
ilit(2188962)
ilit(2828322)
ilit(388433)
ilit(3924737)
ilit(4571777)
ilit(7763866)
isu
isu
Tryptophan synthase alpha chain (EC 4.2.1.20) PsycPRwf_0756, YP_001279658.1, gi|148652565, InterPro:IPR002028, GeneID:5205743
815 902524 903438 915 + 251 14 4: 18 17 9 8 ff
icw(1)
ilit(
1368738)
isu
isu
isu
Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) PsycPRwf_0757, YP_001279659.1, gi|148652566, InterPro:IPR000438, InterPro:IPR011762, GeneID:5205744
816 903498 904934 1437 + 59 10 6: 6 11 15 5 23 8 ff
icw(1)
isu
isu
Dihydrofolate synthase (EC 6.3.2.12) @ Folylpolyglutamate synthase (EC 6.3.2.17) PsycPRwf_0758, YP_001279660.1, gi|148652567, InterPro:IPR001645, InterPro:IPR013221, GeneID:5204899
817 905215 906819 1605 + 280       cwn Type I secretion system, outer membrane component LapE # AggA PsycPRwf_0759, YP_001279661.1, gi|148652568, InterPro:IPR003423, GeneID:5204900

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Tryptophan_synthesis_Chlora_tempo AndreiO Tryptophan synthase beta chain (EC 4.2.1.20)
Tryptophan_synthesis VeronikaV Tryptophan synthase beta chain (EC 4.2.1.20)
EC_4.2.1.1-25_Hydro-lyases gjo Tryptophan synthase beta chain (EC 4.2.1.20)
Chorismate:_Intermediate_for_synthesis_of_Tryptophan,_PAPA_antibiotics,_PABA,_3-hydroxyanthranilate_and_more. carolb Tryptophan synthase beta chain (EC 4.2.1.20)
Folate_Tryp_Chlamydiae vcrecy Tryptophan synthase beta chain (EC 4.2.1.20)


  Protein Sequence

>fig|349106.5.peg.813 Tryptophan synthase beta chain (EC 4.2.1.20)
MKKIMTTFDNIPHNDEIDDIQDFNQYPDASGHFGIHGGRFVSETLMAALEELETLYYQVK
QDPAFWQEYHNDLVNYVGRPTPLYHAKRLSDEIGGAQIYFKREDLNHTGAHKVNNTIGQA
LLAKMSGKKRIIAETGAGQHGVATATIAARLGLECIIYMGADDVERQKMNVYRMRLLGAK
VVAVESGSRTLKDAMNEAMRDWVTNVDTTYYIIGTVAGPHPYPLLVRDFQAIIGKEARLQ
HLEKTGKLPDALVACVGGGSNAIGLFYEFLNDTDVKMYGVEATGDGIETGRHSAPLAAGR
VGVLHGNRTYLMADDDGQILETHSISAGLDYPGVGPEHSFLKDVKRVEYVGCTDKEALHG
FHEVTRKEGIIPALESSHAVAYALQLAKTMSPEQSIIVNMSGRGDKDLHSVMKAEGIEL

MD5 = 0d1f2517c1a8827037bab897b72aa968


  DNA Sequence

>fig|349106.5.peg.813 Tryptophan synthase beta chain (EC 4.2.1.20)
gtgaaaaaaattatgacaacatttgataatattccgcacaatgatgagattgacgatatc
caagattttaatcagtatccagatgccagtggtcactttggtatccatggcggccgcttc
gtatcagagactctaatggcggcattagaggagcttgagaccttatattatcaagtcaaa
caagaccctgcattttggcaggagtaccacaatgacttagtcaattatgtgggtcgtcca
acgccgctttatcatgccaagcgtttgagtgatgagattggcggcgcgcagatttatttt
aagcgtgaagatttaaaccacaccggcgcgcacaaagtaaacaacaccatcggtcaggcg
ctactggctaagatgagcggcaaaaaacgtattattgccgagaccggtgcgggtcaacat
ggcgtggcaacagcgacgattgcagcacggctaggacttgagtgtattatttatatgggc
gcagatgacgtcgagcgtcaaaaaatgaacgtgtatcgtatgcgtctgcttggggctaaa
gtggtggcggttgagtctggttcacggacgctaaaagatgcgatgaacgaggcgatgcgt
gattgggtgaccaatgttgataccacctattatattattggtacggtcgcagggccgcac
ccttatccgttattggtgcgtgattttcaggccattattggtaaagaggcgcgtctgcag
catctagagaaaaccggcaaactgcctgatgcacttgtcgcctgtgtgggcggcggatcc
aatgccattggtctgttctatgagttcttaaatgataccgatgtcaaaatgtatggcgta
gaggcgacaggtgatggtatcgaaaccggccgtcactcagcgccgctagcggcaggccgc
gtcggggtgttgcatggcaatcgcacttatctgatggccgatgatgatggtcagatccta
gagacgcattcaatctcagcaggtcttgattatccgggcgtgggccctgagcacagcttc
ttaaaagatgtgaagcgggtagagtatgtgggctgtactgataaagaggcgctacatggt
tttcatgaagtgacccgaaaagaaggtattattccggcgcttgagtcctcgcacgcggtc
gcttatgccttacagcttgccaaaaccatgagtcctgagcagagcatcatcgtcaatatg
tcaggccgtggtgataaggatttgcactcggtaatgaaggctgaaggcattgagctttaa


  DNA with Flanking Sequence

>fig|349106.5.peg.813 Tryptophan synthase beta chain (EC 4.2.1.20)
actagcccaagccgtgaacaaacgctggattaaagcacttcgtattaataaagagcaaga
tacgcctgactcgattcgagcccagattgacgcctttgcacaagccggtgccagcagtat
cttacttgatgcctatcataaacaggcgtatggcggtacaggggagcgctttgattggtc
gctcattccaaaagatgccagcctgcctatcattttggcaggcgggctaacccctgaaaa
tgtgagtgaggttattaatcagagtttaccgatacaggctgtggatgtaagcggtggcat
tgagtcggcaaagggtatcaaagatgcgggcaagatggcggcctttgttcgcgccgttaa
aagtaatcgatggcaacacggttagtacgatttgcagtcgcagtcatcaccaatatacgc
tgcccatacccaataaataaacacagtaagatacaatcatacggcgcacagcgtcagcca
gcttaattaaaaaaaacagggtgaaaaaaattatgacaacatttgataatattccgcaca
atgatgagattgacgatatccaagattttaatcagtatccagatgccagtggtcactttg
gtatccatggcggccgcttcgtatcagagactctaatggcggcattagaggagcttgaga
ccttatattatcaagtcaaacaagaccctgcattttggcaggagtaccacaatgacttag
tcaattatgtgggtcgtccaacgccgctttatcatgccaagcgtttgagtgatgagattg
gcggcgcgcagatttattttaagcgtgaagatttaaaccacaccggcgcgcacaaagtaa
acaacaccatcggtcaggcgctactggctaagatgagcggcaaaaaacgtattattgccg
agaccggtgcgggtcaacatggcgtggcaacagcgacgattgcagcacggctaggacttg
agtgtattatttatatgggcgcagatgacgtcgagcgtcaaaaaatgaacgtgtatcgta
tgcgtctgcttggggctaaagtggtggcggttgagtctggttcacggacgctaaaagatg
cgatgaacgaggcgatgcgtgattgggtgaccaatgttgataccacctattatattattg
gtacggtcgcagggccgcacccttatccgttattggtgcgtgattttcaggccattattg
gtaaagaggcgcgtctgcagcatctagagaaaaccggcaaactgcctgatgcacttgtcg
cctgtgtgggcggcggatccaatgccattggtctgttctatgagttcttaaatgataccg
atgtcaaaatgtatggcgtagaggcgacaggtgatggtatcgaaaccggccgtcactcag
cgccgctagcggcaggccgcgtcggggtgttgcatggcaatcgcacttatctgatggccg
atgatgatggtcagatcctagagacgcattcaatctcagcaggtcttgattatccgggcg
tgggccctgagcacagcttcttaaaagatgtgaagcgggtagagtatgtgggctgtactg
ataaagaggcgctacatggttttcatgaagtgacccgaaaagaaggtattattccggcgc
ttgagtcctcgcacgcggtcgcttatgccttacagcttgccaaaaccatgagtcctgagc
agagcatcatcgtcaatatgtcaggccgtggtgataaggatttgcactcggtaatgaagg
ctgaaggcattgagctttaagccaattatttaatacagcgggcgtgttataggcccgcag
cagttatcaccttatatgttaagagaccatcatgactcgaattgaaagcacctttgagac
cttaaaagcgcaaaacaaaaaagccctaatcccttatgttatggcgggtgacccttcccc
aaatagcttcgtggacttactgcatgatttagtaaaacatggggccgatatgattgaagt
gggattgccattttcagacccaatggcggatggcccgactgtggcattggctggtgagcg
cgccttagcaggcggtaccagtacccatcaggcgctggctatagtcaaaaaattccgtga
acaagacagcagcacgcccattatcttaatgggttatctcaatccgattgagattatcgg
ttatgaggcctttattgccttgtgtcacgaatcaggggtcgatggggtgttggtcgtgga
tctaccgcctgctgaatcaggtaattttgttgagcgcttg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
21 fig|349106.5.peg.812 Phosphoribosylanthranilate isomerase (EC 5.3.1.24)
34 fig|349106.5.peg.814 Tryptophan synthase alpha chain (EC 4.2.1.20)
14 fig|349106.5.peg.815 Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)
10 fig|349106.5.peg.816 Dihydrofolate synthase (EC 6.3.2.12) @ Folylpolyglutamate synthase (EC 6.3.2.17)


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
evidence_code icw(2);Chorismate:_Intermediate_for_synthesis_of_Tryptophan,_PAPA_antibiotics,_PABA,_3-hydroxyanthranilate_and_more.
evidence_code icw(2);Tryptophan_synthesis
evidence_code ilit(10361288);fig|100226.1.peg.2003
evidence_code ilit(10628865);fig|69014.3.peg.4
evidence_code ilit(1773058);fig|223926.1.peg.1960
evidence_code ilit(2211532);fig|62977.3.peg.282
evidence_code ilit(2299982);fig|62977.3.peg.282
evidence_code ilit(2828322);fig|190650.1.peg.3518
evidence_code ilit(8159786);fig|1148.1.peg.2867
evidence_code ilit(8581158);fig|272843.1.peg.578
evidence_code ilit(9097426);fig|100226.1.peg.2003
evidence_code isu;Chorismate:_Intermediate_for_synthesis_of_Tryptophan,_PAPA_antibiotics,_PABA,_3-hydroxyanthranilate_and_more.
evidence_code isu;Tryptophan_synthesis


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search