The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|323259.5.peg.2052: Methanospirillum hungatei JF-1

This feature in The SEED Viewer

NCBI Taxonomy Id: 323259

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig NC_007796 from base 2175123 to 2188289 (13167 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2045 2176943 2175123 1821 -           signal-transducing histidine kinase Mhun_1933
2046 2176959 2177579 621 + 15     24: 19 2 14 15 23 11 9 17 8 12 3 20 1 13 16 7 28 5 10 4 32 6 21 18 ff
ilit(
10350464)
isu
isu
Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3) Mhun_1934
2047 2177646 2178410 765 + 66     21: 2 14 15 11 9 17 8 12 3 41 1 13 16 7 5 10 4 27 22 6 18 ff
ilit(
15375115)
isu
isu
Thiazole biosynthetic enzyme Thi4 @ anaerobic-type Thi4 Mhun_1935
2048 2178870 2178415 456 - 4     5: 33 36 26 30 42   tRNA (adenine(37)-N6)-methyltransferase Mhun_1936
2049 2179501 2178881 621 - 10         Tryptophan-rich sensory protein TspO Mhun_1937
2050 2179724 2179933 210 + 222     3: 25 37 40 ff
idu(2)
ilit(
11714910)
Translation initiation factor 1A Mhun_1938
2051 2180035 2180316 282 + 101     1: 38   hypothetical protein  
2052 2180370 2181602 1233 + 53     9: 35 39 31 45 34 24 46 44 43 ff
ilit(
6751404)
isu
isu
isu
Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) Mhun_1939
2053 2182426 2181617 810 - 14         Integral membrane protein Mhun_1940
2054 2182903 2182433 471 - 6     1: 29   Two-component transcriptional response regulator, LuxR family Mhun_1941
2055 2183170 2184441 1272 + 266         Metallo-beta-lactamase superfamily Mhun_1942
2056 2186291 2184492 1800 - 50         Two-component system sensor histidine kinase Mhun_1943
2057 2186352 2188289 1938 + 60         FOG: PKD repeat Mhun_1944

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase, catabolic (EC 4.3.1.19)
YggSProC belyacoubi Threonine dehydratase, catabolic (EC 4.3.1.19)
Glycine_and_Serine_Utilization OlgaZ Threonine dehydratase, catabolic (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
AdiR Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
COG2945 Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
COG2945 Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)


  Protein Sequence

>fig|323259.5.peg.2052 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MTDNLFQDIQSAGIRIAPHVIRTPLIYSSTFSRITNAHVYLKLETLQKAGSFKIRGAMNK
ILIHANKAGPAGVVTASAGNHAQGVSVAAQIAGIPATVIMPFWSSLSKQEASRGYGADVH
LFGKTLEESMQRARELADEGMLYVHPFDDPEIIAGQGTIGLEICDALPSPDIVVVPVGGG
GLISGISVAVKNKVPSCRIIGVQVQACPSAYQAKYGGGEVSETTGWTLADGIRVTRTGTH
SLPYIRDMVDQIVLVDDGEISDAMLWLLERKKIVAEGAGTTPLAALLSQKFSFSPGSTIV
LVISGGNIDSHQLSRVIRQALARRGRLMRLSLVIEDQPGSLAEVLAIIAREGGNILKISH
SEWDIELPVHEKRIWIEIETRGPSHIAAIEKVLSNVGIQTSGFSDEMTGK

MD5 = e8fbfc7a1c33f6ad51292c7181e7c8de


  DNA Sequence

>fig|323259.5.peg.2052 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgactgacaatctttttcaggatatccaatcagcggggataagaattgctccccatgtg
atcaggacgccgctcatctattcatccacattctcccggataacgaatgcccatgtgtat
cttaaacttgaaacgctgcagaaggccggatcgtttaagattcggggcgctatgaacaag
atcctcattcatgcgaacaaggcaggaccagcgggagtggtcacggcatcagccggtaat
catgcccagggcgtgtctgttgctgcccagatagccggcattcctgcaaccgtcattatg
ccgttctggtcttccctttcaaaacaggaggcatcacgaggatatggggctgatgttcac
ctgttcggaaaaacccttgaagagtcgatgcagcgggcgagggaactggcagatgaaggg
atgctatatgtccacccgtttgatgatccggagattattgcaggtcagggaacgataggg
cttgagatctgcgacgctcttccttcacctgatatcgtcgtagtgccggtcggtgggggg
ggtctgatctccggcatcagtgtggcggtaaaaaacaaagtgccgtcatgccggattatc
ggggttcaggtgcaggcatgtccctcagcatatcaggcaaaatatgggggaggtgaggtg
agtgaaacaaccggatggaccctcgcagatggaatccgggtaaccagaaccggtacacac
agtcttccatacattcgtgatatggttgatcagatcgtccttgttgatgatggggagatc
tcggatgccatgctgtggctccttgagcgaaagaagattgttgccgaaggagccggaacg
acccctcttgcagcactcctgtctcagaaattttcattctctcccggcagcaccatcgtt
cttgtcatcagtggaggaaatatcgacagccatcagctgtccagggtgatcaggcaggcc
cttgccagacggggcagactgatgcggcttagtcttgttattgaggatcaacccggctcc
cttgcagaagtgctggctatcatcgcacgggaaggagggaacatcctgaagatcagccat
agtgagtgggatattgaactcccggttcatgaaaagagaatatggatagagatagaaacc
cgggggccttcacacattgcagcgatagaaaaagtcctgtcgaatgtgggcattcaaaca
tccggtttttctgatgagatgactggaaaataa


  DNA with Flanking Sequence

>fig|323259.5.peg.2052 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
cgatatctcataccggtatacccctcctcagcgtgactggttgagacggaacaagtatat
ctaatattctcttccgatttctttttcactctcatttttgcatcgtccggtattatcagc
cgggagagagcaaaggtatttaatcttataaaaaaagggtaaagtatgtctccacgggtt
attgatccagctcctgcccggagataccgggagaagcaaggcagaataagtaaggaccgg
gcgcgttatctggagacgctccgtcatcatcccatggcaacgccctatccgcatcctgca
cgaaaagcctggaggaaacgttccgaaccagggccatggcatactactcacagtcatccc
catcaggaagaactcggccctcacaccaaccagcctggcccgatccggtttccggtggcc
attatcctgaagggaaaaagagcgtaagaccaaagggcatcatttttttcggttctgaaa
ggaacgttccggacaggtccatgactgacaatctttttcaggatatccaatcagcgggga
taagaattgctccccatgtgatcaggacgccgctcatctattcatccacattctcccgga
taacgaatgcccatgtgtatcttaaacttgaaacgctgcagaaggccggatcgtttaaga
ttcggggcgctatgaacaagatcctcattcatgcgaacaaggcaggaccagcgggagtgg
tcacggcatcagccggtaatcatgcccagggcgtgtctgttgctgcccagatagccggca
ttcctgcaaccgtcattatgccgttctggtcttccctttcaaaacaggaggcatcacgag
gatatggggctgatgttcacctgttcggaaaaacccttgaagagtcgatgcagcgggcga
gggaactggcagatgaagggatgctatatgtccacccgtttgatgatccggagattattg
caggtcagggaacgatagggcttgagatctgcgacgctcttccttcacctgatatcgtcg
tagtgccggtcggtggggggggtctgatctccggcatcagtgtggcggtaaaaaacaaag
tgccgtcatgccggattatcggggttcaggtgcaggcatgtccctcagcatatcaggcaa
aatatgggggaggtgaggtgagtgaaacaaccggatggaccctcgcagatggaatccggg
taaccagaaccggtacacacagtcttccatacattcgtgatatggttgatcagatcgtcc
ttgttgatgatggggagatctcggatgccatgctgtggctccttgagcgaaagaagattg
ttgccgaaggagccggaacgacccctcttgcagcactcctgtctcagaaattttcattct
ctcccggcagcaccatcgttcttgtcatcagtggaggaaatatcgacagccatcagctgt
ccagggtgatcaggcaggcccttgccagacggggcagactgatgcggcttagtcttgtta
ttgaggatcaacccggctcccttgcagaagtgctggctatcatcgcacgggaaggaggga
acatcctgaagatcagccatagtgagtgggatattgaactcccggttcatgaaaagagaa
tatggatagagatagaaacccgggggccttcacacattgcagcgatagaaaaagtcctgt
cgaatgtgggcattcaaacatccggtttttctgatgagatgactggaaaataatatttca
agccttttcaggctgatattgccatccgaatcgccagcaggataagcattccgataaaaa
gtacctgtaacttcttctctgacatggtgctccctgtcttcaccccaaacctgacagcag
gaattgaggtaaggaccaggaccaggacaaacaggaggtttacatacccgatagagaagg
gaaaaagaccggtcactccccatccaagaacgatataggagaccaccgttcctgacgcaa
taaggaccatggcggtaagcgagatacctatggatttgtggatattcattcccagaattg
atgtcagtaccggtgtcagaattacgccgccaccaatcccaaagagcccggatgcaactc
ccacaccaatgccgaggatgaggaggatgaaatcagtctccctgacggcatatgcacaca
gatatctgcattgtttgatgatcatccacacagccatgaagatcaaaaagccggagaatg
caaggatatgaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004794       F:L-threonine ammonia-lyase activity
GO:0008152       P:metabolic process
GO:0016597       F:amino acid binding
GO:0030170       F:pyridoxal phosphate binding
cmr|NT06MH2343 Methanospirillum hungatei JF-1     threonine dehydratase
gb|ABD41650.1 Methanospirillum hungatei JF-1     L-threonine ammonia-lyase
gi|88188653 Methanospirillum hungatei JF-1 NCBI   L-threonine ammonia-lyase
gi|88603191 Methanospirillum hungatei JF-1 NCBI   threonine dehydratase
img|637897549 Methanospirillum hungatei JF-1 IMG   threonine dehydratase
kegg|mhu:Mhun_1939 Methanospirillum hungatei JF-1 KEGG   threonine dehydratase
ref|YP_503369.1 Methanospirillum hungatei JF-1 RefSeq   threonine dehydratase
tr|Q2FRH4 Methanospirillum hungatei (strain JF-1 / DSM 864) TrEMBL   L-threonine ammonia-lyase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code ff
evidence_code ilit(6751404);fig|99287.1.peg.3134
evidence_code isu;Branched-Chain_Amino_Acid_Biosynthesis
evidence_code isu;Glycine_and_Serine_Utilization
evidence_code isu;Threonine_degradation
isoelectric_point 6.02
molecular_weight 18
PFAM::PF00291 925.590;16-306
PFAM::PF01842 0.0;328-398
similar_to_human yes


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search