The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|316401.4.peg.87: Escherichia coli ETEC H10407

This feature in The SEED Viewer

NCBI Taxonomy Id: 316401

Current Assignment: Acetolactate synthase small subunit (EC 2.2.1.6)
Translate Function Assignments



Context on contig FN649414 from base 85385 to 96606 (11222 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
81 86956 85385 1572 -       1: 1 dlit(16011356) 2-isopropylmalate synthase (EC 2.3.3.13) locus|ETEC_0073, protein_id|CBI99574.1, gi|309700286
82 87161 87256 96 + 204         hypothetical protein  
83 87596 87718 123 + 339         hypothetical protein  
84 87795 88739 945 + 76       dlit(20659289)
dlit(19429622)
LysR family transcriptional activator LeuO ## leuABCD operon (and possibly CRISPR immunity) locus|ETEC_0075, protein_id|CBI99576.1, gi|309700288
85 88872 88997 126 + 132         hypothetical protein  
86 89081 90781 1701 + 83     1: 1 dlit(1512191) Acetolactate synthase large subunit (EC 2.2.1.6) locus|ETEC_0076, protein_id|CBI99577.1, gi|309700289
87 90754 91275 522 + -28     1: 1 dlit(23512804) Acetolactate synthase small subunit (EC 2.2.1.6) locus|ETEC_0077, protein_id|CBI99578.1, gi|309700290
88 91327 91458 132 + 51         hypothetical protein  
89 91455 92459 1005 + -4       dlit(8230205) Fructose repressor FruR, LacI family locus|ETEC_0078, protein_id|CBI99579.1, gi|309700291
90 92737 92621 117 - 161         hypothetical protein  
91 93061 93519 459 + 323       dlit(24659771) Transcriptional regulator MraZ locus|ETEC_0079, protein_id|CBI99580.1, gi|309700292
92 93521 94462 942 + 1       dlit(10572301)
dlit(19965768)
16S rRNA (cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) ## RsmH locus|ETEC_0080, protein_id|CBI99581.1, gi|309700293
93 94459 94824 366 + -4       dlit(1332942) Cell division protein FtsL locus|ETEC_0081, protein_id|CBI99582.1, gi|309700294
94 94840 96606 1767 + 15     1: 2 dlit(6350821)
dlit(9614966)
Cell division protein FtsI, peptidoglycan D,D-transpeptidase (EC 3.4.16.4) locus|ETEC_0082, protein_id|CBI99583.1, gi|309700295

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Acetolactate synthase small subunit (EC 2.2.1.6)


  Protein Sequence

>fig|316401.4.peg.87 Acetolactate synthase small subunit (EC 2.2.1.6)
MVKQNGENLIMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQT
VGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRG
QIIDVTPSLYTVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR

MD5 = 8d0593ff2b9ec1a715b7538b68bd395b


  DNA Sequence

>fig|316401.4.peg.87 Acetolactate synthase small subunit (EC 2.2.1.6)
gtggttaagcaaaacggagagaacctgattatgcgccggatattatcagtcttactcgaa
aatgaatcaggcgcgttatcccgcgtgattggccttttttcccagcgtggctacaacatt
gaaagcctgaccgttgcgccaaccgacgatccgacattatcgcgtatgaccatccagacc
gtgggcgatgaaaaagtacttgagcagatcgaaaagcaattacacaaactggtcgatgtc
ttgcgcgtgagtgagttggggcagggcgcgcatgttgagcgggaaatcatgctggtgaaa
attcaggccagcggttacgggcgtgacgaagtgaaacgtaatacggaaatattccgtggg
caaattatcgatgtcacaccctcgctttataccgttcaattagcaggcaccagcggtaag
cttgatgcatttttagcatcgattcgcgatgtggcgaaaattgtggaggttgctcgctct
ggtgtggtcggactttcgcgcggcgataaaataatgcgttga


  DNA with Flanking Sequence

>fig|316401.4.peg.87 Acetolactate synthase small subunit (EC 2.2.1.6)
atgtttgctgcactttattatccattcgacaaaccgcgtcgctggatcaattccggtggc
ctcggcacgatgggttttggtttacctgcggcactgggcgtcaaaatggcgttgccagaa
gaaaccgtggtttgcgtcactggcgacggcagtattcagatgaacatccaggaactgtct
accgcgttgcaatacgagttgcccgtactggtggtgaatctcaataaccgctatctgggg
atggtgaagcagtggcaggacatgatctattccggccgtcattcacaatcttatatgcaa
tcgctacccgatttcgtccgtctggcggaagcctatgggcatgtcgggatccagatttct
catccgcatgagctggaaagcaaacttagcgaggcgctggaacaggtgcgcaataatcgc
ctggtgtttgttgatgttaccgtcgatggcagcgagcacgtctacccgatgcagattcgc
gggggcggaatggatgaaatgtggttaagcaaaacggagagaacctgattatgcgccgga
tattatcagtcttactcgaaaatgaatcaggcgcgttatcccgcgtgattggcctttttt
cccagcgtggctacaacattgaaagcctgaccgttgcgccaaccgacgatccgacattat
cgcgtatgaccatccagaccgtgggcgatgaaaaagtacttgagcagatcgaaaagcaat
tacacaaactggtcgatgtcttgcgcgtgagtgagttggggcagggcgcgcatgttgagc
gggaaatcatgctggtgaaaattcaggccagcggttacgggcgtgacgaagtgaaacgta
atacggaaatattccgtgggcaaattatcgatgtcacaccctcgctttataccgttcaat
tagcaggcaccagcggtaagcttgatgcatttttagcatcgattcgcgatgtggcgaaaa
ttgtggaggttgctcgctctggtgtggtcggactttcgcgcggcgataaaataatgcgtt
gagaatgatctcaatgcgcaatttacagcccaacatgtcacgttgggctttttttgcgaa
atcagtgggaacctggaataaaagcagttgccgcagttaattttctgcgcttagatgtta
atgaatttaacccataccagtacaatggctatggtttttacattttacgcaaggggcaat
tgtgaaactggatgaaatcgctcggctggcgggagtgtcgcggaccactgcaagctatgt
tattaacggcaaagcgaagcaataccgtgtgagcgacaaaaccgttgaaaaagtcatggc
tgtggtgcgtgagcacaattaccacccgaacgccgtggcagctgggcttcgtgctggacg
cacacgttctattggtcttgtgatccccgatctggagaacaccagctatacccgcatcgc
taactatcttgaacgccaggcgcggcaacggggttatcaactgctgattgcctgctcaga
agatcagccagacaacgaaatg


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(23512804);moussulubin


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search