The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|314260.3.peg.1296: Parvularcula bermudensis HTCC2503

This feature in The SEED Viewer

NCBI Taxonomy Id: 314260

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig PbermHTCC2503.contigs_2 from base 1220018 to 1231362 (11345 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1291 1220018 1220947 930 +           Strictosidine synthase family protein  
1292 1222085 1221024 1062 - 76     3: 2 1 3 ff
icw(3)
icw(4)
ilit(
10810156)
ilit(10940051)
ilit(15299625)
ilit(15663922)
ilit(1730062)
ilit(17449626)
ilit(1748999)
ilit(3110742)
ilit(4889950)
ilit(6321488)
ilit(6330094)
ilit(6396161)
ilit(7590327)
ilit(7881901)
ilit(8119295)
ilit(8294021)
ilit(8336106)
ilit(8405446)
ilit(8569539)
ilit(8875643)
ilit(9086278)
ilit(9108278)
ilit(9111927)
ilit(9720199)
ilit(9873079)
isu
isu
3-isopropylmalate dehydrogenase (EC 1.1.1.85)  
1293 1222660 1222082 579 - -4     3: 2 1 3 ff
icw(3)
icw(3)
ilit(
1400210)
ilit(17449626)
ilit(20170198)
ilit(8331070)
ilit(9813279)
isu
isu
3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)  
1294 1224060 1222657 1404 - -4     5: 2 4 5 1 3 ff
icw(3)
icw(5)
ilit(
12070767)
ilit(1400210)
ilit(17449626)
ilit(2190189)
ilit(9813279)
isu
isu
3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)  
1295 1225241 1224057 1185 - -4     3: 2 1 3 ff
icw(3)
icw(6)
ilit(
12070767)
ilit(12432038)
ilit(17189332)
ilit(2181403)
ilit(2420798)
ilit(3275644)
ilit(8117072)
ilit(8701612)
ilit(9139910)
isu
isu
2-isopropylmalate synthase (EC 2.3.3.13)  
1296 1226651 1225365 1287 - 123     3: 12 8 1 ff
icw(2)
ilit(
1400210)
ilit(782558)
isu
isu
Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)  
1297 1226949 1226635 315 - -17         Acetolactate synthase small subunit (EC 2.2.1.6)  
1298 1228653 1226950 1704 - 0     1: 1 ff
icw(6)
ilit(
10213630)
ilit(11902841)
ilit(1400210)
ilit(2336405)
ilit(2989781)
ilit(2989782)
ilit(2989783)
ilit(6308579)
ilit(8366043)
ilit(9688822)
isu
Acetolactate synthase large subunit (EC 2.2.1.6)  
1299 1229694 1228672 1023 - 18     7: 7 11 9 13 6 10 1 ff
icw(4)
ilit(
1398116)
ilit(1400210)
ilit(1744032)
ilit(8173081)
ilit(8366043)
ilit(8379936)
ilit(8448371)
ilit(8529876)
isu
isu
Ketol-acid reductoisomerase (NADP(+)) (EC 1.1.1.86)  
1300 1231362 1229701 1662 - 6     3: 4 5 1 ff
icw(4)
ilit(
1400210)
ilit(3550695)
ilit(8299945)
ilit(8325851)
isu
Dihydroxy-acid dehydratase (EC 4.2.1.9)  

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase (EC 4.3.1.19)
YggSProC belyacoubi Threonine dehydratase (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase (EC 4.3.1.19)


  Protein Sequence

>fig|314260.3.peg.1296 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MPLSSDPEPAVRGEAAAPSPRAAFSLSDQEWRAIVDKTDPAWQEIRETPCLPSRKLGALT
NCRLWLKYENLQYIGAFKERGALAKLLSLSDAERQSGVVAASAGNHAQGLARHAELLGIR
ATIVMPAQTPSVKVEETKRFGAEVILHGTDFEAAHAEAIRQVEEEGKTLVHPFDDPYVAA
GQGTIAKEMLCEAPEIDTLVIPIGGGGLIAGMAAVAKEMRPDIRIIGVQAALYPGMANAV
RNESAPCGGMTLAEGIAVCDPGRFTREVVARLVDEIVTVDERALERSLSLLLMTQKTLAE
GAGAAGLAALLAHPHLFEGHAVGTIVCGGNIDPRLLSSILMRDLARQRRLARLRVPLMDV
PGQLTRVSAAIGAAGGNVIDVSYHKVFNDLPAKQTHLDISVEATGPAHMDRIVEALRAEG
LEPEVANY

MD5 = e45373e50ce9cde5dc001a2564980e61


  DNA Sequence

>fig|314260.3.peg.1296 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgccactgtcatctgatcctgagcccgctgtacgcggcgaggcggccgcgccctctcct
cgcgcggccttctcgctcagcgaccaggaatggcgggccatcgtcgataagaccgatccg
gcgtggcaggaaatccgcgaaacgccctgcttgccgagccgaaagctcggggccctgacg
aattgccgtctttggctgaaatacgagaatctgcaatatatcggcgcctttaaggaacgg
ggcgctttggcgaaattactgtcattgagcgatgccgaacgccaatcaggggtcgtggcc
gcgtcagcgggcaatcacgcccaaggcctcgcccgtcacgccgaactgctcggtattcgc
gcgaccattgtgatgcccgcgcaaacgccctccgtgaaagtcgaggaaaccaagcgcttt
ggggccgaagtgattcttcacgggacggatttcgaagccgcccatgccgaggccatccga
caggtcgaggaggagggcaaaaccctcgtccacccgttcgatgacccctatgtcgccgcc
gggcaagggaccatcgccaaggaaatgctgtgcgaggccccggagatcgataccttggtg
atccccattggcgggggggggctgattgccggcatggccgccgtcgcgaaggaaatgcgt
ccagacatccgcatcatcggcgtgcaagccgcgctctatcccggcatggccaatgcggtt
cgcaacgaaagcgcgccctgcggcggcatgactttggccgagggcatcgccgtctgcgat
ccggggcggtttacccgtgaggtcgtcgcgcgccttgtcgacgagattgtcaccgtcgat
gagcgggcattggagcggtcgctatcgcttttattgatgacccaaaaaaccttggccgaa
ggcgcgggggcggcgggtcttgcagccctgctggcccatccgcatctcttcgaaggtcac
gcggtcggcacgattgtctgtggcggtaatatcgacccgcggctgttgtcgtcgatcctc
atgcgggatctggccaggcaacgacgccttgcccgccttcgggtgccgctgatggatgtc
ccgggccaattgacccgggtgtccgcggcgatcggcgcggcgggcggaaacgttattgat
gtgagctatcataaggtgttcaacgatcttccagcgaagcagacccatctcgatatttcg
gtcgaggcgacgggccctgcgcatatggatcgtatcgtcgaagcgctgcgggccgaaggc
ctggagccggaagtggcaaattactga


  DNA with Flanking Sequence

>fig|314260.3.peg.1296 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
caatccggatttcgccgagattgcaaaagcattcgggatcgaggggttcacgatcagcaa
acgcgacgaggtgacccccgcgatcgaacggttcttatccgcagacgggccgattttgat
gcatgtcatcatcgatccggcggaaaatgtctggcccctcgttcctcagggcgcctccaa
cgaacagatgctggagggctaaatggtggaaaccttcaaccaacgcggcacgatcgagac
catgacgatcgagagcgacgatgtgaacggaaccctgaggcggatttggacggtcatcga
acagcgcggctggtcggtgcgctctctcttggtcgaagaagtcgagggtggggtcgaaac
ccgtgtgcaagtgagcccatacggcaagcaccggtcggttgagacgctgcgcctacagat
cgaacggctctacaatgtccggtcggtgcgccttgagcggcgtagtcgggagaagcccag
ccggtggcaggagatcccccatgccactgtcatctgatcctgagcccgctgtacgcggcg
aggcggccgcgccctctcctcgcgcggccttctcgctcagcgaccaggaatggcgggcca
tcgtcgataagaccgatccggcgtggcaggaaatccgcgaaacgccctgcttgccgagcc
gaaagctcggggccctgacgaattgccgtctttggctgaaatacgagaatctgcaatata
tcggcgcctttaaggaacggggcgctttggcgaaattactgtcattgagcgatgccgaac
gccaatcaggggtcgtggccgcgtcagcgggcaatcacgcccaaggcctcgcccgtcacg
ccgaactgctcggtattcgcgcgaccattgtgatgcccgcgcaaacgccctccgtgaaag
tcgaggaaaccaagcgctttggggccgaagtgattcttcacgggacggatttcgaagccg
cccatgccgaggccatccgacaggtcgaggaggagggcaaaaccctcgtccacccgttcg
atgacccctatgtcgccgccgggcaagggaccatcgccaaggaaatgctgtgcgaggccc
cggagatcgataccttggtgatccccattggcgggggggggctgattgccggcatggccg
ccgtcgcgaaggaaatgcgtccagacatccgcatcatcggcgtgcaagccgcgctctatc
ccggcatggccaatgcggttcgcaacgaaagcgcgccctgcggcggcatgactttggccg
agggcatcgccgtctgcgatccggggcggtttacccgtgaggtcgtcgcgcgccttgtcg
acgagattgtcaccgtcgatgagcgggcattggagcggtcgctatcgcttttattgatga
cccaaaaaaccttggccgaaggcgcgggggcggcgggtcttgcagccctgctggcccatc
cgcatctcttcgaaggtcacgcggtcggcacgattgtctgtggcggtaatatcgacccgc
ggctgttgtcgtcgatcctcatgcgggatctggccaggcaacgacgccttgcccgccttc
gggtgccgctgatggatgtcccgggccaattgacccgggtgtccgcggcgatcggcgcgg
cgggcggaaacgttattgatgtgagctatcataaggtgttcaacgatcttccagcgaagc
agacccatctcgatatttcggtcgaggcgacgggccctgcgcatatggatcgtatcgtcg
aagcgctgcgggccgaaggcctggagccggaagtggcaaattactgatgtttagacgttt
tctggatcagcgacttaggaggcggagaccgcaataatttgtgttctccgcggcccctcc
ctttttgcgccgaaatctcccaagtcttaccgtgatccagagagtgacccatgacctata
cgccccccgagaccgttcgtattttcgataccaccttgcgcgacggcgaacagagccccg
gtttttccatgaccatgaagggcaagctgcgcatggcgcgggccttgtccgcccttaaag
tcgatgtgatcgaggccggctttgccgcggcaagccccggcgatgccgaagccgtacgcg
ccatcgccgccgaagccgatggccccatcgtctgctccctcgcacgggtgaccgagcggg
acatcgatgccgccgccgaagccttgaaagacgccaagaggaagcgggcccatgtcttta
tcggcactagcccgacccatcgacgccacaagctgaaaatgcggaaaggggagatcctcg
acgccat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004794       F:L-threonine ammonia-lyase activity
GO:0008152       P:metabolic process
GO:0016597       F:amino acid binding
GO:0030170       F:pyridoxal phosphate binding
fig|314260.5.peg.1269 Parvularcula bermudensis HTCC2503 FIG   Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
gb|EAQ17640.1 Parvularcula bermudensis HTCC2503     threonine dehydratase
gi|84691800 Parvularcula bermudensis HTCC2503 NCBI   threonine dehydratase
gi|84702554 Parvularcula bermudensis HTCC2503 NCBI   threonine dehydratase
img|638907417 Parvularcula bermudensis HTCC2503 IMG   threonine dehydratase( EC:4.3.1.19 )
ref|ZP_01017129.1 Parvularcula bermudensis HTCC2503 RefSeq   threonine dehydratase
tr|A3VR95 Parvularcula bermudensis HTCC2503 TrEMBL   Threonine dehydratase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::30381 978.300;45-327
CDD::31364 911.100;45-363
CDD::40387 959.100;45-329
evidence_code ff
evidence_code icw(2);Branched-Chain_Amino_Acid_Biosynthesis
evidence_code ilit(1400210);fig|272623.1.peg.1262
evidence_code ilit(782558);fig|4932.3.peg.2080
evidence_code isu;Branched-Chain_Amino_Acid_Biosynthesis
evidence_code isu;Threonine_degradation
isoelectric_point 5.64
molecular_weight 45613
PFAM::PF00291 938.240;41-329
PFAM::PF01842 0.0;351-421
PSORT::Cytoplasmic 8.96
PSORT_score::Cytoplasmic 8.96
similar_to_human yes


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search