The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|306254.1.peg.108: Campylobacter coli RM2228

This feature in The SEED Viewer

NCBI Taxonomy Id: 306254

Current Assignment: Threonine dehydratase (EC 4.3.1.19)
Translate Function Assignments



Context on contig AAFL01000001 from base 99089 to 112333 (13245 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
102 99089 100330 1242 +         ff Ankyrin repeat-containing possible periplasmic protein CCO0894, EAL57620.1, gi|57020956
103 100327 101076 750 + -4     1: 11 ff Short-chain dehydrogenase/reductase SDR CCO0893, EAL57619.1, gi|57020955
104 101073 102803 1731 + -4       ff Na+/H+ antiporter CCO0892, EAL57618.1, gi|57020954
105 102800 103888 1089 + -4     1: 15 ff
isu
tRNA (uracil(54)-C5)-methyltransferase (EC 2.1.1.35) CCO0891, EAL57617.1, gi|57020953
106 104310 103900 411 - 11       ff membrane protein CCO0890, EAL57616.1, gi|57020952
107 104474 104893 420 + 163 4   ff CoA-binding domain protein CCO0889, EAL57615.1, gi|57020951
108 104887 106098 1212 + -7   3: 7 20 29 ff
ilit(
1400210)
ilit(782558)
isu
isu
Threonine dehydratase (EC 4.3.1.19) ilvA, CCO0888, EAL57614.1, gi|57020950
109 106817 106095 723 - -4     4: 31 6 27 1 ff
isu
isu
tRNA pseudouridine synthase A (EC 4.2.1.70) truA, CCO0887, EAL57613.1, gi|57020949
110 107842 106817 1026 - -1       cwn
ff
Predicted permease YjgP/YjgQ family CCO0886, EAL57612.1, gi|57020948
111 108552 107839 714 - -4       ff Putative processing peptidase CCO0885, EAL57611.1, gi|57020947
2040 109276 108608 669 - 55     5: 21 9 10 14 13 ff
ilit(
11076526)
ilit(11114943)
ilit(6712246)
ilit(9882662)
isu
isu
Undecaprenyl diphosphate synthase (EC 2.5.1.31) CCO0884, EAL57610.1, gi|57020946, uppS
113 109896 109279 618 - 2       cwn
ff
FIG00469724: hypothetical protein CCO0883, EAL57609.1, gi|57020945
114 111047 109893 1155 - -4     7: 2 25 22 23 30 18 24 ff
isu
Phosphopantothenoylcysteine decarboxylase (EC 4.1.1.36) / Phosphopantothenoylcysteine synthetase (EC 6.3.2.5) coaBC, CCO0882, EAL57608.1, gi|57020944
2062 112333 111044 1290 - -4     10: 19 3 12 4 8 16 5 28 17 26 ff
ilit(
10428949)
ilit(11118459)
ilit(11124906)
ilit(18263721)
ilit(8083170)
ilit(8407787)
isu
isu
isu
isu
N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157) CCO0881, EAL57607.1, gi|57020943, glmU

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase (EC 4.3.1.19)
YggSProC belyacoubi Threonine dehydratase (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase (EC 4.3.1.19)


  Protein Sequence

>fig|306254.1.peg.108 Threonine dehydratase (EC 4.3.1.19)
MLELNKIYQAKQKIADFVSKTPFIHSSFLSELCKSEVYLKNENLQITGAYKIRGAYNKIA
NLDPEAKKAGVIAASAGNHAQGVAISAKKFDTKAIIVMPESTPLLKVSATKSLGAEVILK
GDNFDEAYAFATNYAKENGLSFIHPFEDELVMAGQGTLMLEMLDDVSDLDTIIAPVGGGG
LISGIASAAKQINPNIKIIAVGAKGAPAMHDSFKAKEVKNSKSVRTIADGIAVRDANPIN
LGIILECVNEFVQVDDEEIANAVLFLLEKHKIIVEGAGAASVAALLHQKIDIKDSKKIGV
VLSGGNIDVQMLNIIIEKGLFKAYRKMQINVTLIDKPGSLLNLTDSLKSANANIVKIDYD
RFSTKLDYGDAMISITLETKGKEHQEEVRNILKDKGFDFYETF

MD5 = 8dc0011712f3ca08bc27e41956ede34e


  DNA Sequence

>fig|306254.1.peg.108 Threonine dehydratase (EC 4.3.1.19)
atgttagaactgaacaaaatttatcaagccaaacaaaaaattgctgattttgtaagcaaa
actccttttatacactcttcttttttaagcgaactttgcaaaagtgaagtgtatttaaaa
aatgaaaatttgcaaattacaggagcttataaaattcgcggtgcatataacaaaatagct
aatttagacccagaagctaaaaaagcaggagttatagctgctagtgctggaaatcacgct
caaggtgttgccataagtgcaaagaaatttgacacaaaagctataatcgtgatgccagaa
tccacccctctcttaaaagtttctgctaccaaaagcttgggtgcagaagttattttaaag
ggtgataattttgacgaagcttatgcttttgcaacaaactatgcgaaagaaaatggatta
agttttattcatccttttgaagatgaacttgtaatggcaggacaaggcacacttatgctt
gaaatgcttgatgatgtaagcgatcttgataccatcatagctcctgtaggcggtggtgga
cttattagcggtatagcaagcgctgcaaagcagattaatcccaatatcaaaattattgca
gtaggtgctaaaggagctcctgcaatgcatgatagctttaaagcaaaagaggttaaaaac
tctaaaagcgtccgtactatagcagatggtattgctgtgcgcgatgctaatcctattaac
ctaggtatcatccttgaatgcgtgaatgaatttgttcaagtagacgatgaagaaatcgct
aatgcggtattgtttttgcttgaaaaacataaaattatagttgaaggcgcaggtgctgca
agcgtagccgccctacttcatcaaaaaatagatataaaagattctaaaaaaatcggcgtt
gttttaagtggcggcaatatcgatgtgcaaatgctaaatatcatcatagaaaagggtctt
tttaaagcttatcgtaaaatgcaaatcaatgttactttaatcgataaaccaggatcccta
cttaatcttacagatagcttaaaatcagccaatgcaaacatagtcaaaattgattatgat
agattttcaacaaagcttgattatggcgatgctatgatttctattaccttagaaactaaa
ggcaaagaacatcaagaagaagttagaaatatcttaaaagataaaggttttgatttttac
gaaactttctaa


  DNA with Flanking Sequence

>fig|306254.1.peg.108 Threonine dehydratase (EC 4.3.1.19)
tataaatatatttttaaattaaaatctatttttaagcgaaataagattatgattaaattt
ttaaaatttttatataaagtaacaacgatggatgaaaatttaatcatagataaaatactc
aacaacacaaaaaccattgccatagtaggacttagccccgatgaaagcaagccttctttt
atgataggacaatttttacaagaaaatcattataaaatttatcctatatatcctaaatgt
gatgaaattttaggagaacgcgtttatcgaagcttagatgatatcgatgaaaaaatagat
cttgttttaatgtttcgcaagggcgaatttgcctcttcattactcccaagtattatccgt
aaaggaattcaaaatttttggctgcagcttggaatttgcaacaatgaagttgctaaagaa
tgcgaaaatttaaagattaattttatacaggataaatgcattatgcgtgaattgccactt
tatcaagataggataagcaaatgttagaactgaacaaaatttatcaagccaaacaaaaaa
ttgctgattttgtaagcaaaactccttttatacactcttcttttttaagcgaactttgca
aaagtgaagtgtatttaaaaaatgaaaatttgcaaattacaggagcttataaaattcgcg
gtgcatataacaaaatagctaatttagacccagaagctaaaaaagcaggagttatagctg
ctagtgctggaaatcacgctcaaggtgttgccataagtgcaaagaaatttgacacaaaag
ctataatcgtgatgccagaatccacccctctcttaaaagtttctgctaccaaaagcttgg
gtgcagaagttattttaaagggtgataattttgacgaagcttatgcttttgcaacaaact
atgcgaaagaaaatggattaagttttattcatccttttgaagatgaacttgtaatggcag
gacaaggcacacttatgcttgaaatgcttgatgatgtaagcgatcttgataccatcatag
ctcctgtaggcggtggtggacttattagcggtatagcaagcgctgcaaagcagattaatc
ccaatatcaaaattattgcagtaggtgctaaaggagctcctgcaatgcatgatagcttta
aagcaaaagaggttaaaaactctaaaagcgtccgtactatagcagatggtattgctgtgc
gcgatgctaatcctattaacctaggtatcatccttgaatgcgtgaatgaatttgttcaag
tagacgatgaagaaatcgctaatgcggtattgtttttgcttgaaaaacataaaattatag
ttgaaggcgcaggtgctgcaagcgtagccgccctacttcatcaaaaaatagatataaaag
attctaaaaaaatcggcgttgttttaagtggcggcaatatcgatgtgcaaatgctaaata
tcatcatagaaaagggtctttttaaagcttatcgtaaaatgcaaatcaatgttactttaa
tcgataaaccaggatccctacttaatcttacagatagcttaaaatcagccaatgcaaaca
tagtcaaaattgattatgatagattttcaacaaagcttgattatggcgatgctatgattt
ctattaccttagaaactaaaggcaaagaacatcaagaagaagttagaaatatcttaaaag
ataaaggttttgatttttacgaaactttctaataagaaattctactcagataaagtccac
aaggcggggctaaaaaatgattgtattgttttttagcttcgatttgctcttttaactctt
ctatactcatcttattttctaaaacttttaaaacactcgcaaccattagtcttatttgcg
cccttaaaaaaccattagccttaaaacgaaaaatggtaaaatccttataagaatacgctt
tagctaaaaatatttctctgatagtcgttttattatctcctccgctcttgcaaaagaatt
taaaatccttaatacctacaaaattttgcaaaacaagatcagcctttaaaacatcaataa
aaggataaaaatgaacataagaagctaaaaaaggattataaaccccgtgataaaaaatat
agcgatattctctactttttacatcgtatcttacttcaaaatttgaaggcatgattttta
aatttttaacatgtataaaaggatgagaaaatttattgatttgttttttaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004794       F:L-threonine ammonia-lyase activity
GO:0006520       P:amino acid metabolic process
GO:0030170       F:pyridoxal phosphate binding
fig|306254.7.peg.112 Campylobacter coli RM2228 FIG   Threonine dehydratase (EC 4.3.1.19)
gb|EAL57614.1 Campylobacter coli RM2228     threonine dehydratase
gi|57020950 Campylobacter coli RM2228 NCBI   threonine dehydratase
gi|57167828 Campylobacter coli RM2228 NCBI   threonine dehydratase
img|638473635 Campylobacter coli RM2228 IMG   threonine dehydratase( EC:4.2.1.16 )
ref|ZP_00366968.1 Campylobacter coli RM2228 RefSeq   threonine dehydratase
tr|Q4HIC7 Campylobacter coli RM2228 TrEMBL   Threonine dehydratase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|306254.1.peg.107 CoA-binding domain protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::30381 974.200;14-302
CDD::30844 974.100;21-306
CDD::40387 950.200;14-305
CELLO::cytoplasm 4.223
evidence_code ff
evidence_code ilit(1400210);fig|272623.1.peg.1262
evidence_code ilit(782558);fig|4932.3.peg.2080
evidence_code isu;Branched-Chain_Amino_Acid_Biosynthesis
evidence_code isu;Threonine_degradation
isoelectric_point 6.42
molecular_weight 43649
PFAM::PF00291 917.690;14-305
PSORT::unknown unknown
similar_to_human yes
structure Stuctural classification projected from homologous protein in E. coli
structure Stuctural classification projected from homologous protein in E. coli
TMPRED 1194;171-189


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search