The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|273057.1.peg.220: Sulfolobus solfataricus P2

This feature in The SEED Viewer

NCBI Taxonomy Id: 273057

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig NC_002754 from base 208923 to 220551 (11629 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
215 208923 209972 1050 +       1: 5 ff Possible subunit variant of phosphoribosylaminoimidazolecarboxamide formyltransferase [alternate form] SSO0241, NP_341792.1, gi|15897187, GeneID:1455392
216 210097 211104 1008 + 124     9: 5 40 8 17 31 23 42 47 44 ff
icw(1)
ilit(
10346917)
ilit(1448066)
ilit(1592113)
ilit(3058695)
ilit(7490761)
ilit(7603488)
ilit(8308018)
ilit(8376380)
ilit(8706758)
ilit(8790347)
isu
isu
Adenylosuccinate synthetase (EC 6.3.4.4) purA, SSO0242, NP_341793.1, gi|15897188, GeneID:1455393
217 211105 212514 1410 + 0       ff FAD-dependent dehydrogenase PH0303 SSO0244, NP_341794.1, gi|15897189, GeneID:1455394
218 212541 213524 984 + 26     8: 25 29 41 22 15 24 53 16 ff
isu
Siroheme decarboxylase subunit AhbA (EC 4.1.1.111) / Siroheme decarboxylase subunit AhbB (EC 4.1.1.111) nirD, SSO0245, NP_341795.1, gi|15897190, GeneID:1455395
219 214310 213501 810 - -24     6: 20 52 43 38 21 19 ff
ilit(
17115705)
isu
isu
Prephenate dehydratase (EC 4.2.1.51) # PheAIp/ACT domain pheA, SSO0246, NP_341796.1, gi|15897191, GeneID:1455396
220 215556 214339 1218 - 28     11: 37 46 28 58 11 9 10 12 60 56 51 ff
ilit(
1400210)
ilit(782558)
isu
isu
Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) tdcB, SSO0248, NP_341797.1, gi|15897192, GeneID:1455397
221 216095 215580 516 - 23         HIT family protein aq_2159 hit, SSO0249, NP_341798.1, gi|15897193, GeneID:1455398
222 217109 216135 975 - 39     1: 45 ff
ilit(
10903318)
ilit(8668545)
isu
dlit(9573041)
dlit(10931349)
DNA repair and recombination protein RadA radA, SSO0250, NP_341799.1, gi|15897194, GeneID:1455399
223 217711 217166 546 - 56     1: 1   Uncharacterized protein SSO0251 SSO0251, NP_341800.1, gi|15897195, GeneID:1455400
224 218709 217690 1020 - -22     6: 36 50 7 18 6 1 ff
idu(2)
ilit(
20600111)
tRNA/RNA cytosine-C5-methylase SSO0252, NP_341801.1, gi|15897196, GeneID:1455401
225 218719 219279 561 + 9     7: 49 57 32 48 2 4 3 ff
ilit(
1970565)
ilit(8226661)
isu
Adenylate cyclase, class IV (EC 4.6.1.1) cyaB, SSO0253, NP_341802.1, gi|15897197, GeneID:1455402
226 219233 220078 846 + -47     3: 55 39 13   protein of unknown function DUF62 SSO0254, NP_341803.1, gi|15897198, GeneID:1455403
227 220198 220551 354 + 119     12: 33 2 26 14 34 27 54 4 3 59 35 30 ff
ilit(
10331644)
ilit(10986466)
ilit(9401030)
isu
isu
dlit(15078171)
Nicotinamide-nucleotide adenylyltransferase, NadM family (EC 2.7.7.1) SSO0255, NP_341804.1, gi|15897199, GeneID:1455404

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Threonine_degradation OlgaV Threonine dehydratase (EC 4.3.1.19)
YggSProC belyacoubi Threonine dehydratase (EC 4.3.1.19)
Branched-Chain_Amino_Acid_Biosynthesis SvetaG Threonine dehydratase (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
RidA_family_in_981_representative_prokaryotes Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
TN_RidA:_all_subgroups,_981_genomes_PLP Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
AdiR Ernst_Dustin_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user Threonine dehydratase, catabolic (EC 4.3.1.19)
GB_RidA_family_in_981_representative_prokaryotes Beaudoin_Guillaume_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
COG2945 Niehaus_Tom_user Threonine dehydratase, catabolic (EC 4.3.1.19)
COG2945 Niehaus_Tom_user L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Leucine,_Isoleucine,_and_Valine_biosynthesis_HGM_New Kutt_Laura_user Threonine dehydratase, catabolic (EC 4.3.1.19)
Propionate_production_HGM Threonine dehydratase, catabolic (EC 4.3.1.19)
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|273057.1.peg.220 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MNYLEYFDRIRLAKEKIEKYVHITPIDYSTTFSRIINAKVYLKLENLQKTGSFKVRGAFN
KLLSLKEEEKKNGVIAVSAGNHAQGVAYAASTLNIKSTIVMPETAPASKYLATKSYGAEV
VLYGKYLHESMKKAEELIQNTGLIFVHPYSDLDVITGQGTIGLELYDIEPDYVIIPIGGG
GLISGISIALKYRFPNVKIIGVQSSSSPSMKVSKDLGRLVEIEPSYSIADGILVKSPSEL
TFSIINELVDDIVLVDDEEIAEAIVLLLERSKTLAEGAGAAALASLISGKVKVNGIDKKV
ISLVSGGNIDLSLLSTLTEKFLYRQKRVVKVRVIVPDKPGQLNKVLSYVVKIRGNIIDIV
HDRHSSDVLPGYTKIYITFELQSSEAITLLLTNLANEGIDVKIVE

MD5 = b0c2ef7a39588f2ac524dc90efd1c93b


  DNA Sequence

>fig|273057.1.peg.220 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgaattacttagaatattttgatagaattagactagcaaaagagaaaatagaaaaatat
gtgcatattactccaatagattattctacaacgttttccagaattataaacgcaaaagtt
tatcttaagttggaaaatctacagaaaactggatcattcaaagttagaggtgcctttaat
aagttattatctttaaaggaggaagaaaaaaagaatggcgttattgcagtttcagcaggt
aatcatgctcaaggagttgcttatgcagcctccacgttaaatatcaaatcgactatagtg
atgccagaaacagctccagcttccaagtatttagctacaaaatcctatggggcagaagta
gttctttatggtaagtacttgcatgagagtatgaagaaagcggaagaattgattcaaaat
actggtttaatatttgttcatccttatagtgatttagatgtgataacgggtcaaggtacc
ataggattagaattgtatgatatcgaaccagattacgtaattattccaatagggggtgga
ggattgatttctggtataagtatagctttaaagtatagattcccaaacgtcaagataata
ggcgttcagtcttcttcttctccttcaatgaaggtttctaaggatcttgggaggcttgta
gaaatagagcctagttattccatagctgatggcatattggttaagtctccttctgaatta
acctttagtataattaatgagttagtagatgatatagtattagtggatgatgaagaaata
gctgaggcaatagttttactacttgaaagaagtaaaacgctagcagaaggagcaggagct
gcagcattagcgtcactaatttcagggaaggttaaagtaaatggaatagacaaaaaagta
atttcattagtaagtgggggaaatattgacttatcattattgtctactctaacagagaag
tttttatatagacaaaaaagggtagtcaaagtgagggtaatagttccagataagccagga
cagttaaataaagtattaagctatgtagttaagatcagaggtaatataatagatattgtt
catgataggcacagtagtgatgtattgcctggatacactaaaatatatataactttcgag
cttcagtcttcagaggctattaccttacttctgacaaatctggcaaacgagggaatagac
gtgaaaattgtagaatag


  DNA with Flanking Sequence

>fig|273057.1.peg.220 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
tctgaaactagcaaggtaaaacaagatgaatgcttattttgtagagtaataaaagaagaa
aatgacgaacaaaattacatagtatatagaggaaaacacgcttttataatactcaacgct
tttccctataataccgctcatgtgatggttgttccttacagacacgtcccttcagttgag
cttttaagtaatgatgaggcattagacatatttactttatctactattgcaataagagct
ataagagatatttatgctccagacggttttaatataggcgtaaacataggtagagtggca
ggagcaggtatagaatctcatattcacgttcatatcgtgccgagatggaatggtgattcc
aattttatgccggtcatttttaacactaaggtcatgccagaaacactcagcgatacgttt
aaaaaattaaatacaaaagttaatgagattatgaagaagccctcgagatctgagtaattg
atgaaggcagggttttacagatgaattacttagaatattttgatagaattagactagcaa
aagagaaaatagaaaaatatgtgcatattactccaatagattattctacaacgttttcca
gaattataaacgcaaaagtttatcttaagttggaaaatctacagaaaactggatcattca
aagttagaggtgcctttaataagttattatctttaaaggaggaagaaaaaaagaatggcg
ttattgcagtttcagcaggtaatcatgctcaaggagttgcttatgcagcctccacgttaa
atatcaaatcgactatagtgatgccagaaacagctccagcttccaagtatttagctacaa
aatcctatggggcagaagtagttctttatggtaagtacttgcatgagagtatgaagaaag
cggaagaattgattcaaaatactggtttaatatttgttcatccttatagtgatttagatg
tgataacgggtcaaggtaccataggattagaattgtatgatatcgaaccagattacgtaa
ttattccaatagggggtggaggattgatttctggtataagtatagctttaaagtatagat
tcccaaacgtcaagataataggcgttcagtcttcttcttctccttcaatgaaggtttcta
aggatcttgggaggcttgtagaaatagagcctagttattccatagctgatggcatattgg
ttaagtctccttctgaattaacctttagtataattaatgagttagtagatgatatagtat
tagtggatgatgaagaaatagctgaggcaatagttttactacttgaaagaagtaaaacgc
tagcagaaggagcaggagctgcagcattagcgtcactaatttcagggaaggttaaagtaa
atggaatagacaaaaaagtaatttcattagtaagtgggggaaatattgacttatcattat
tgtctactctaacagagaagtttttatatagacaaaaaagggtagtcaaagtgagggtaa
tagttccagataagccaggacagttaaataaagtattaagctatgtagttaagatcagag
gtaatataatagatattgttcatgataggcacagtagtgatgtattgcctggatacacta
aaatatatataactttcgagcttcagtcttcagaggctattaccttacttctgacaaatc
tggcaaacgagggaatagacgtgaaaattgtagaatagtttataagtcttctatgtagag
atttaggtggtagatgcggatggaatttattatttaggtccagagggaagttttacacac
gaagcagctagtttgtttaaaggaaaagatcttaaggcagaatcaacgatatctttagta
tttaagagagtttatgaaagagaaagttcaataggcatagttcccatagaaaatagcctc
gaaggaccagtaaatgaaacgcttgataatctctacaattatgataatatatatgttata
ggcgagattgagaaaaagatagaactagttctagcagcaagaagtgataatttgagtcag
attaagagaatatactcgcatcctcacgcatttaacgaagctagagaaaagttaaaggaa
ttaggctttaatgaatatatacctgtagaaagcacttcaaaagcagcaaagattgtgtct
caagattcagaggcagcagctatttgttctaattttgcagccaaactttataatttga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004794       F:L-threonine ammonia-lyase activity
GO:0008152       P:metabolic process
GO:0016597       F:amino acid binding
GO:0030170       F:pyridoxal phosphate binding
cmr|NT02SS0248 Sulfolobus solfataricus P2     threonine dehydratase
gb|AAK40587.1 Sulfolobus solfataricus P2     Threonine dehydratase catabolic (threonine deaminase) (tdcB)
gb|EER54597.1 Sulfolobus solfataricus 98/2     threonine dehydratase
gi|13813385 Sulfolobus solfataricus P2 NCBI   Threonine dehydratase catabolic (threonine deaminase) (tdcB)
gi|15897192 Sulfolobus solfataricus P2 NCBI   threonine dehydratase
gi|241219556 Sulfolobus solfataricus 98/2 NCBI   threonine dehydratase
gi|241768854 Sulfolobus solfataricus 98/2 NCBI   threonine dehydratase
img|638161469 Sulfolobus solfataricus P2 IMG   Threonine dehydratase catabolic (threonine deaminase) (tdcB)( EC:4.2.1.16 )
kegg|sso:SSO0248 Sulfolobus solfataricus P2 KEGG   threonine dehydratase
ref|NP_341797.1 Sulfolobus solfataricus P2 RefSeq   threonine dehydratase
ref|ZP_04766278.1 Sulfolobus solfataricus 98/2 RefSeq   threonine dehydratase
tr|C5SSH5 Sulfolobus solfataricus 98/2 TrEMBL   Threonine dehydratase
tr|Q980P1 Sulfolobus solfataricus TrEMBL   Threonine dehydratase catabolic (Threonine deaminase) (TdcB)


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
CDD::30381 974.300;24-284
CDD::30844 976.800;34-306
CDD::40387 948.400;17-307
evidence_code ff
evidence_code ilit(1400210);fig|272623.1.peg.1262
evidence_code ilit(782558);fig|4932.3.peg.2080
evidence_code isu;Branched-Chain_Amino_Acid_Biosynthesis
evidence_code isu;Threonine_degradation
IPR::IPR000362_interpro_download 212.0;113-337
IPR::IPR000362_interpro_download 311.3;3-357
IPR::IPR001926_interpro_download 271.0;17-307
IPR::IPR001926_interpro_download 395.9;32-365
IPR::IPR005789_interpro_download 578.9;24-403
isoelectric_point 7.83
molecular_weight 44364
PANTHER::PTHR10314_interpro_download 395.9;32-365
PFAM::PF00291 922.230;17-307
PFAM::PF00291_interpro_download 271.0;17-307
PRINTS::PR00149_interpro_download 212.0;113-337
similar_to_human yes
SSF::SSF53686_interpro_download 311.3;3-357
structure Stuctural classification projected from homologous protein in E. coli
TIGRFAMs::TIGR01127_interpro_download 578.9;24-403


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search