The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|273036.6.peg.267: Staphylococcus aureus RF122

This feature in The SEED Viewer

NCBI Taxonomy Id: 273036

Current Assignment: FIG01108223: hypothetical protein
Translate Function Assignments



Context on contig NC_007622 from base 282731 to 294211 (11481 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
258 282731 283123 393 +       1: 1   EsaC protein within ESAT-6 gene cluster (S.aureus type) locus|SAB0229, protein_id|YP_415734.1, gi|82749993, geneID|3792749
259 283139 283453 315 + 15     1: 1   10 kDa culture filtrate antigen CFP-10 (EsxB) locus|SAB0230, protein_id|YP_415735.1, gi|82749994, geneID|3792750
260 283450 284127 678 + -4     1: 1   SAV0291 homolog within ESAT-6 gene cluster locus|SAB0231, protein_id|YP_415736.1, gi|82749995, geneID|3792751
261 284127 284444 318 + -1         FIG01108475: hypothetical protein locus|SAB0232, protein_id|YP_415737.1, gi|82749996, geneID|3792752
262 284454 285833 1380 + 9     1: 1   Lmo0066 homolog within ESAT-6 gene cluster, similarity to ADP-ribosylating toxins  
263 286050 286298 249 + 216     1: 1   Lmo0066 homolog within ESAT-6 gene cluster, similarity to ADP-ribosylating toxins  
264 286309 286800 492 + 10     1: 1   Repetitive hypothetical protein near ESAT cluster, SA0282 homolog locus|SAB0234, protein_id|YP_415738.1, gi|82749997, geneID|3792754
265 287002 287685 684 + 201         FIG01107881: hypothetical protein locus|SAB0235, protein_id|YP_415739.1, gi|82749998, geneID|3792755
266 287830 287982 153 + 144         FIG01108223: hypothetical protein  
267 288023 288442 420 + 40         FIG01108223: hypothetical protein locus|SAB0236, protein_id|YP_415740.1, gi|82749999, geneID|3792756
268 288574 288443 132 - 0         hypothetical protein  
269 288660 289160 501 + 85     1: 1   Repetitive hypothetical protein near ESAT cluster, SA0282 homolog locus|SAB0237, protein_id|YP_415741.1, gi|82750000, geneID|3792757
270 289171 289671 501 + 10     1: 1   Repetitive hypothetical protein near ESAT cluster, SA0282 homolog locus|SAB0238, protein_id|YP_415742.1, gi|82750001, geneID|3792758
271 289682 290170 489 + 10     1: 1   Repetitive hypothetical protein near ESAT cluster, SA0282 homolog locus|SAB0239, protein_id|YP_415743.2, gi|229307090, geneID|3792759
272 290776 291150 375 + 605         FIG01108407: hypothetical protein locus|SAB0240, protein_id|YP_415744.1, gi|82750003, geneID|3792760
273 291378 291695 318 + 227         hypothetical protein locus|SAB0241, protein_id|YP_415745.1, gi|82750004, geneID|3792761
274 292770 291949 822 - 253         formate/nitrite transporter family protein locus|SAB0242c, protein_id|YP_415746.1, gi|82750005, geneID|3792762
275 294211 293009 1203 - 238         Branched-chain amino acid transport system carrier protein locus|SAB0243c, protein_id|YP_415747.1, gi|82750006, geneID|3792763

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|273036.6.peg.267 FIG01108223: hypothetical protein
MGSLFYAWMAFRNIWNRPLLLKYKNITDSSSGIVNKSEYNAVESLRINIEIAKYKGIISL
IVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIIIFAVWDLIIRVRKGTFAFVVIR
PILFSCWLFILNMILSRLL

MD5 = bbdff1e8dae6d56148646972f22b1826


  DNA Sequence

>fig|273036.6.peg.267 FIG01108223: hypothetical protein
atggggagtttgttttatgcatggatggcttttagaaatatttggaacagaccactatta
ctaaaatataagaacattacagatagttcaagtggaatagttaataaatctgaatacaat
gcagttgaaagcttacgtataaacattgaaatagctaagtataaagggattatttctttg
atagtagctatagtattaacggtattaatgacattaaaatcaacacctcaaattactgca
gaaacacgtgacttaagtatctcatttttcatactcagcttatttatcattataatattt
gcagtttgggatttgattattagagttagaaagggaacgtttgcttttgttgtaataagg
ccaatattatttagttgttggttatttattttgaatatgattttatcaagattattataa


  DNA with Flanking Sequence

>fig|273036.6.peg.267 FIG01108223: hypothetical protein
aaaaattatcgaatatatattgattcctaatgtcgtagaatccaagtttataattattgt
aagcatgttggttatcgctggagcacaatttgtggcatttcaatttattatgcaatacag
tagattctatatttttgaattaaacacagaagaagatgactaaataattttataaattct
gtggagtatacttatataagaaaatcaacttcaacgtatatcaccatattattttatact
caatgatgtgaatgaatttaagtggattgatattaaagtaaaagttatggaatattgagg
tgcgaatatggagttcttattattaattgtcgtagccggactgtattatattatatattt
aactgctgtgatgtattctgaaaaaatagtagtattgcctataatcatctatgccattgt
gtttgtagtaattggtatcacttatattttttataggtgacagctatgatcagttaacaa
atttcaatgtgattttgtatatggggagtttgttttatgcatggatggcttttagaaata
tttggaacagaccactattactaaaatataagaacattacagatagttcaagtggaatag
ttaataaatctgaatacaatgcagttgaaagcttacgtataaacattgaaatagctaagt
ataaagggattatttctttgatagtagctatagtattaacggtattaatgacattaaaat
caacacctcaaattactgcagaaacacgtgacttaagtatctcatttttcatactcagct
tatttatcattataatatttgcagtttgggatttgattattagagttagaaagggaacgt
ttgcttttgttgtaataaggccaatattatttagttgttggttatttattttgaatatga
ttttatcaagattattataattataagaagttgaataaattgtaaagtgaaaaatcattg
agaatttcaattattgtaacaataatttcttttgctttagatttattagcatatttaggt
ttaaaatgagtaatattattttgaagaagcattaagcgacgtagaggtgttgttttaatg
ctttttatttaacagtaatgaaatcaatatctattttgaaaatataggggcgataacatg
actttcgaagagaaattaagtgaaatgtataacgagattgcgaatgagattagtgggatg
atacctgtagagtggggaaaggtatatgcaatggcatatatagatgatgaaggaggcgaa
gtgttctactattacacagaacctggaagcaatgaattatactactatactagtgtatta
aataaatatgatatatcggaatcagaatttatggactcagagtatgagttgtataaacaa
tttcaaaagttaagaaatatatttaaaaaagaaggacatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT11SA0247 Staphylococcus aureus RF122     putative membrane protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search