The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.919: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: UPF0738 protein YjbL
Translate Function Assignments



Context on contig NC_002745 from base 972441 to 983756 (11316 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
914 972441 973427 987 +       1: 4   Competence protein CoiA locus|SA0858, protein_id|NP_374121.1, gi|15926588, geneID|1123675
915 973475 975283 1809 + 47         Oligoendopeptidase F locus|SA0859, protein_id|NP_374122.1, gi|15926589, geneID|1123676
916 976549 975743 807 - 459     3: 7 12 1   FIG00002411: Thioredoxin-fold protein locus|SA0860, protein_id|NP_374123.1, gi|15926590, geneID|1123677
917 976937 976572 366 - 22     1: 2   Hemoglobin-like protein HbO locus|SA0861, protein_id|NP_374124.1, gi|15926591, geneID|1123678
918 977634 977041 594 - 103     5: 9 11 8 10 1   Adenylate cyclase (EC 4.6.1.1) locus|SA0862, protein_id|NP_374125.1, gi|15926592, geneID|1123679
919 977820 978167 348 + 185       UPF0738 protein YjbL locus|SA0863, protein_id|NP_374126.1, gi|15926593, geneID|1123680
920 978184 978819 636 + 16 7 1: 1   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM locus|SA0864, protein_id|NP_374127.1, gi|15926594, geneID|1123681
921 978836 979645 810 + 16     3: 3 5 1   NAD kinase (EC 2.7.1.23) gene_name|ppnK, locus|SA0865, protein_id|NP_374128.1, gi|15926595, geneID|1123682
922 979642 980496 855 + -4 6 2: 6 1   Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type locus|SA0866, protein_id|NP_374129.1, gi|15926596, geneID|1123683
923 980517 981902 1386 + 20         Mg/Co/Ni transporter MgtE, CBS domain-containing locus|SA0867, protein_id|NP_374130.1, gi|15926597, geneID|1123684
924 981912 983756 1845 + 9         K+/H+ antiporter / Trk system K+ uptake protein TrkA, NAD-binding C-terminal locus|SA0868, protein_id|NP_374131.1, gi|15926598, geneID|1123685

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.919 UPF0738 protein YjbL
MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
WTMLHENTTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE

MD5 = e4bfdc1dfc5e4ae5d7a5d4d1ad90dc93


  DNA Sequence

>fig|158879.11.peg.919 UPF0738 protein YjbL
atgcgtttatatattaatgaaattaaaattaaagatgacatactttattgttatacagaa
gattctattaaaggattatctgaagtaggacaaatgctcgttgatagtgataattatgcc
tttgcgtatacattagatgatggtaaagcgtatgcttatctcattttcgtacaagaaaca
tggacgatgttgcatgaaaacacgactaaaaaaattattatcaatgatgaactagaattg
actgaattccaccaagaacttacttatattttagacaacataaaagggaataataattat
ggtaaggaatttgttgcaaccgttgaagaaacattcgacattgaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.919 UPF0738 protein YjbL
aactataatttgacgaatgtcatctggaagattgtcgtttgaaataatcaagttcatctc
tggtttaatgtcgacgatatagttgtattctaatagaccaacctttgctggtgtctttaa
agtcatttcatattgattgtctttaactcttatgcgtagtgcagagcgatgttcctttaa
tttgaaatcgggtgtatcaatatagtaattgacttgcttaaaaagcacactgtctttaaa
atatttctcttgcaatttattatagattgatgcagttatcatttgtttaaattctatttc
atgatttgttgccatgatatgtatacacctcgtatcaaattcaatttatcttaactatat
tatgaatgacaaagttgaattttaaaagcaatttcctttatctattatcaatgttaattt
gaccattaaaaatagtgttcgtaagtgttttgtattattgaattgtgttaaaatgttatg
gaataagaggaggattaagcatgcgtttatatattaatgaaattaaaattaaagatgaca
tactttattgttatacagaagattctattaaaggattatctgaagtaggacaaatgctcg
ttgatagtgataattatgcctttgcgtatacattagatgatggtaaagcgtatgcttatc
tcattttcgtacaagaaacatggacgatgttgcatgaaaacacgactaaaaaaattatta
tcaatgatgaactagaattgactgaattccaccaagaacttacttatattttagacaaca
taaaagggaataataattatggtaaggaatttgttgcaaccgttgaagaaacattcgaca
ttgaataaagcggggtgaagcactatgaatcaatgggatcagttcttaacaccttataag
caagcggttgatgagttgaaagtgaaacttaaaggcatgcgcaaacaatatgaagttggt
gaacaagcgtcgccaatagaatttgttactggtcgtgttaaaccgatcgctagtattata
gataaggcaaacaaacgacaaataccatttgataggttaagagaagaaatgtacgatatc
gctggtttaagaatgatgtgccaatttgtagaagatattgatgttgtcgtcaatatttta
agacaaagaaaagattttaaagtaattgaagaacgagattatattcgtaacactaaagaa
agtggttaccgctcgtatcatgtcattattgaatatccaattgaaacattacaaggccaa
aaatttatattggctgagattcagattcgtacattagcaatgaatttctgggcaacgatt
gaacatactttacgatataaatatgatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0935 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0992 Staphylococcus aureus Mu50     conserved hypothetical protein
dbj|BAB42104.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57167.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF77882.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.1005 Staphylococcus aureus subsp. aureus Mu50 FIG   UPF0738 protein YjbL
fig|158878.14.peg.1030 Staphylococcus aureus subsp. aureus Mu50 FIG   UPF0738 protein YjbL
fig|158879.1.peg.887 Staphylococcus aureus subsp. aureus N315 FIG   UPF0738 protein YjbL
fig|359786.13.peg.1073 Staphylococcus aureus subsp. aureus JH9 FIG   UPF0738 protein YjbL
fig|359786.3.peg.34 Staphylococcus aureus subsp. aureus JH9 FIG   UPF0738 protein YjbL
fig|359787.3.peg.1758 Staphylococcus aureus subsp. aureus JH1 FIG   UPF0738 protein YjbL
fig|418127.4.peg.922 Staphylococcus aureus subsp. aureus Mu3 FIG   UPF0738 protein YjbL
fig|505321.3.peg.1688 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   UPF0738 protein YjbL
fig|553565.3.peg.1801 Staphylococcus aureus A5937 FIG   UPF0738 protein YjbL
fig|553568.3.peg.2286 Staphylococcus aureus A6224 FIG   UPF0738 protein YjbL
fig|553571.3.peg.2016 Staphylococcus aureus A6300 FIG   UPF0738 protein YjbL
fig|553573.3.peg.248 Staphylococcus aureus A8115 FIG   UPF0738 protein YjbL
fig|553574.3.peg.1368 Staphylococcus aureus A8117 FIG   UPF0738 protein YjbL
fig|553577.3.peg.1471 Staphylococcus aureus A8796 FIG   UPF0738 protein YjbL
fig|553580.3.peg.950 Staphylococcus aureus A8819 FIG   UPF0738 protein YjbL
fig|553581.3.peg.1056 Staphylococcus aureus A9299 FIG   UPF0738 protein YjbL
fig|553588.3.peg.2213 Staphylococcus aureus A9719 FIG   UPF0738 protein YjbL
fig|553592.3.peg.35 Staphylococcus aureus A9763 FIG   UPF0738 protein YjbL
fig|553601.3.peg.856 Staphylococcus aureus A10102 FIG   UPF0738 protein YjbL
fig|585891.3.peg.1028 Staphylococcus aureus subsp. aureus Mu50-omega FIG   UPF0738 protein YjbL
fig|680649.3.peg.908 Staphylococcus aureus subsp. aureus MR1 FIG   UPF0738 protein YjbL
fig|681288.4.peg.972 Staphylococcus aureus subsp. aureus ED98 FIG   UPF0738 protein YjbL
fig|703339.3.peg.973 Staphylococcus aureus 04-02981 FIG   UPF0738 protein YjbL
gb|ABQ48804.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_1003
gb|ABR51878.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEV27574.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65891.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66640.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV72921.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76205.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV77251.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV79770.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV85688.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|13700808 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246775 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740506 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1003
gi|148267437 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1003
gi|149945942 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393490 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1022
gi|156721465 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979330 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0999
gi|15923995 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1005
gi|15926593 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0863
gi|226696071 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SAHV_0999
gi|226734045 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SaurJH9_1003
gi|226734055 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SaurJH1_1022
gi|253316166 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_08487
gi|255005793 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04970
gi|257789234 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795262 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257841450 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842212 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257848938 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852279 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854301 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257856867 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257862923 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258406911 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421879 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258435277 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258441489 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258446969 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449947 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258455043 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|81705929 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SA0863
gi|81781846 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SAV1005
img|637092504 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099517 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|639108927 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565353 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640779109 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640903740 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_1022 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1003 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sau:SA0863   KEGG   hypothetical protein
kegg|sav:SAV1005   KEGG   hypothetical protein
kegg|saw:SAHV_0999 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371529.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1005
ref|NP_374126.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0863
ref|YP_001246380.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1003
ref|YP_001316165.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1022
ref|YP_001441589.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0999
ref|ZP_04839379.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_08487
ref|ZP_05144394.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04970
ref|ZP_05644241.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680064.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684800.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05689016.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05690849.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695122.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05698045.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05703006.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
sp|A5IRI1 Staphylococcus aureus (strain JH9) SwissProt   RecName: Full=UPF0738 protein SaurJH9_1003
sp|A6U0B0 Staphylococcus aureus (strain JH1) SwissProt   RecName: Full=UPF0738 protein SaurJH1_1022
sp|A7X0M9 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=UPF0738 protein SAHV_0999
sp|Q7A6E2 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=UPF0738 protein SA0863
sp|Q99V86 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=UPF0738 protein SAV1005
sp|Y1003_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SaurJH9_1003
sp|Y1005_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SAV1005
sp|Y1022_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SaurJH1_1022
sp|Y863_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SA0863
sp|Y999_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SAHV_0999


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|158879.11.peg.920 GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
6 fig|158879.11.peg.922 Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search