The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.919: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: UPF0738 protein YjbL
Translate Function Assignments



Context on contig NC_002745 from base 972441 to 983756 (11316 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
914 972441 973427 987 +       1: 3   Competence protein CoiA locus|SA0858, protein_id|NP_374121.1, gi|15926588, geneID|1123675
915 973475 975283 1809 + 47         Oligoendopeptidase F locus|SA0859, protein_id|NP_374122.1, gi|15926589, geneID|1123676
916 976549 975743 807 - 459     3: 2 11 1   FIG00002411: Thioredoxin-fold protein locus|SA0860, protein_id|NP_374123.1, gi|15926590, geneID|1123677
917 976937 976572 366 - 22     1: 8   Hemoglobin-like protein HbO locus|SA0861, protein_id|NP_374124.1, gi|15926591, geneID|1123678
918 977634 977041 594 - 103     5: 5 12 4 9 1   Adenylate cyclase (EC 4.6.1.1) locus|SA0862, protein_id|NP_374125.1, gi|15926592, geneID|1123679
919 977820 978167 348 + 185       UPF0738 protein YjbL locus|SA0863, protein_id|NP_374126.1, gi|15926593, geneID|1123680
920 978184 978819 636 + 16 7 1: 1   GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM locus|SA0864, protein_id|NP_374127.1, gi|15926594, geneID|1123681
921 978836 979645 810 + 16     3: 10 6 1   NAD kinase (EC 2.7.1.23) gene_name|ppnK, locus|SA0865, protein_id|NP_374128.1, gi|15926595, geneID|1123682
922 979642 980496 855 + -4 6 2: 7 1   tRNA pseudouridine(32) synthase Yjbo locus|SA0866, protein_id|NP_374129.1, gi|15926596, geneID|1123683
923 980517 981902 1386 + 20         Mg/Co/Ni transporter MgtE, CBS domain-containing locus|SA0867, protein_id|NP_374130.1, gi|15926597, geneID|1123684
924 981912 983756 1845 + 9         K+/H+ antiporter / Trk system K+ uptake protein TrkA, NAD-binding C-terminal locus|SA0868, protein_id|NP_374131.1, gi|15926598, geneID|1123685

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.919 UPF0738 protein YjbL
MRLYINEIKIKDDILYCYTEDSIKGLSEVGQMLVDSDNYAFAYTLDDGKAYAYLIFVQET
WTMLHENTTKKIIINDELELTEFHQELTYILDNIKGNNNYGKEFVATVEETFDIE

MD5 = e4bfdc1dfc5e4ae5d7a5d4d1ad90dc93


  DNA Sequence

>fig|158879.11.peg.919 UPF0738 protein YjbL
atgcgtttatatattaatgaaattaaaattaaagatgacatactttattgttatacagaa
gattctattaaaggattatctgaagtaggacaaatgctcgttgatagtgataattatgcc
tttgcgtatacattagatgatggtaaagcgtatgcttatctcattttcgtacaagaaaca
tggacgatgttgcatgaaaacacgactaaaaaaattattatcaatgatgaactagaattg
actgaattccaccaagaacttacttatattttagacaacataaaagggaataataattat
ggtaaggaatttgttgcaaccgttgaagaaacattcgacattgaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.919 UPF0738 protein YjbL
aactataatttgacgaatgtcatctggaagattgtcgtttgaaataatcaagttcatctc
tggtttaatgtcgacgatatagttgtattctaatagaccaacctttgctggtgtctttaa
agtcatttcatattgattgtctttaactcttatgcgtagtgcagagcgatgttcctttaa
tttgaaatcgggtgtatcaatatagtaattgacttgcttaaaaagcacactgtctttaaa
atatttctcttgcaatttattatagattgatgcagttatcatttgtttaaattctatttc
atgatttgttgccatgatatgtatacacctcgtatcaaattcaatttatcttaactatat
tatgaatgacaaagttgaattttaaaagcaatttcctttatctattatcaatgttaattt
gaccattaaaaatagtgttcgtaagtgttttgtattattgaattgtgttaaaatgttatg
gaataagaggaggattaagcatgcgtttatatattaatgaaattaaaattaaagatgaca
tactttattgttatacagaagattctattaaaggattatctgaagtaggacaaatgctcg
ttgatagtgataattatgcctttgcgtatacattagatgatggtaaagcgtatgcttatc
tcattttcgtacaagaaacatggacgatgttgcatgaaaacacgactaaaaaaattatta
tcaatgatgaactagaattgactgaattccaccaagaacttacttatattttagacaaca
taaaagggaataataattatggtaaggaatttgttgcaaccgttgaagaaacattcgaca
ttgaataaagcggggtgaagcactatgaatcaatgggatcagttcttaacaccttataag
caagcggttgatgagttgaaagtgaaacttaaaggcatgcgcaaacaatatgaagttggt
gaacaagcgtcgccaatagaatttgttactggtcgtgttaaaccgatcgctagtattata
gataaggcaaacaaacgacaaataccatttgataggttaagagaagaaatgtacgatatc
gctggtttaagaatgatgtgccaatttgtagaagatattgatgttgtcgtcaatatttta
agacaaagaaaagattttaaagtaattgaagaacgagattatattcgtaacactaaagaa
agtggttaccgctcgtatcatgtcattattgaatatccaattgaaacattacaaggccaa
aaatttatattggctgagattcagattcgtacattagcaatgaatttctgggcaacgatt
gaacatactttacgatataaatatgatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0935 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0992 Staphylococcus aureus Mu50     conserved hypothetical protein
dbj|BAB42104.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57167.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF77882.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.1005 Staphylococcus aureus subsp. aureus Mu50 FIG   UPF0738 protein YjbL
fig|158878.14.peg.1030 Staphylococcus aureus subsp. aureus Mu50 FIG   UPF0738 protein YjbL
fig|158879.1.peg.887 Staphylococcus aureus subsp. aureus N315 FIG   UPF0738 protein YjbL
fig|359786.13.peg.1073 Staphylococcus aureus subsp. aureus JH9 FIG   UPF0738 protein YjbL
fig|359786.3.peg.34 Staphylococcus aureus subsp. aureus JH9 FIG   UPF0738 protein YjbL
fig|359787.3.peg.1758 Staphylococcus aureus subsp. aureus JH1 FIG   UPF0738 protein YjbL
fig|418127.4.peg.922 Staphylococcus aureus subsp. aureus Mu3 FIG   UPF0738 protein YjbL
fig|505321.3.peg.1688 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   UPF0738 protein YjbL
fig|553565.3.peg.1801 Staphylococcus aureus A5937 FIG   UPF0738 protein YjbL
fig|553568.3.peg.2286 Staphylococcus aureus A6224 FIG   UPF0738 protein YjbL
fig|553571.3.peg.2016 Staphylococcus aureus A6300 FIG   UPF0738 protein YjbL
fig|553573.3.peg.248 Staphylococcus aureus A8115 FIG   UPF0738 protein YjbL
fig|553574.3.peg.1368 Staphylococcus aureus A8117 FIG   UPF0738 protein YjbL
fig|553577.3.peg.1471 Staphylococcus aureus A8796 FIG   UPF0738 protein YjbL
fig|553580.3.peg.950 Staphylococcus aureus A8819 FIG   UPF0738 protein YjbL
fig|553581.3.peg.1056 Staphylococcus aureus A9299 FIG   UPF0738 protein YjbL
fig|553588.3.peg.2213 Staphylococcus aureus A9719 FIG   UPF0738 protein YjbL
fig|553592.3.peg.35 Staphylococcus aureus A9763 FIG   UPF0738 protein YjbL
fig|553601.3.peg.856 Staphylococcus aureus A10102 FIG   UPF0738 protein YjbL
fig|585891.3.peg.1028 Staphylococcus aureus subsp. aureus Mu50-omega FIG   UPF0738 protein YjbL
fig|680649.3.peg.908 Staphylococcus aureus subsp. aureus MR1 FIG   UPF0738 protein YjbL
fig|681288.4.peg.972 Staphylococcus aureus subsp. aureus ED98 FIG   UPF0738 protein YjbL
fig|703339.3.peg.973 Staphylococcus aureus 04-02981 FIG   UPF0738 protein YjbL
gb|ABQ48804.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_1003
gb|ABR51878.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEV27574.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65891.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV66640.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV72921.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76205.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV77251.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV79770.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV85688.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|13700808 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14246775 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147740506 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1003
gi|148267437 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1003
gi|149945942 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393490 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1022
gi|156721465 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156979330 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0999
gi|15923995 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1005
gi|15926593 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0863
gi|226696071 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SAHV_0999
gi|226734045 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SaurJH9_1003
gi|226734055 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SaurJH1_1022
gi|253316166 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_08487
gi|255005793 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_04970
gi|257789234 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795262 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257841450 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842212 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257848938 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852279 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854301 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257856867 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257862923 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258406911 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421879 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258435277 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258441489 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258446969 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449947 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258455043 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|81705929 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SA0863
gi|81781846 organism not parsed/found in ncbi nr NCBI   RecName: Full=UPF0738 protein SAV1005
img|637092504 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099517 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|639108927 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565353 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640779109 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640903740 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_1022 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1003 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sau:SA0863   KEGG   hypothetical protein
kegg|sav:SAV1005   KEGG   hypothetical protein
kegg|saw:SAHV_0999 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371529.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1005
ref|NP_374126.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0863
ref|YP_001246380.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1003
ref|YP_001316165.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1022
ref|YP_001441589.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0999
ref|ZP_04839379.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_08487
ref|ZP_05144394.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_04970
ref|ZP_05644241.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680064.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684800.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05689016.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05690849.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695122.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05698045.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05703006.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
sp|A5IRI1 Staphylococcus aureus (strain JH9) SwissProt   RecName: Full=UPF0738 protein SaurJH9_1003
sp|A6U0B0 Staphylococcus aureus (strain JH1) SwissProt   RecName: Full=UPF0738 protein SaurJH1_1022
sp|A7X0M9 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=UPF0738 protein SAHV_0999
sp|Q7A6E2 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=UPF0738 protein SA0863
sp|Q99V86 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=UPF0738 protein SAV1005
sp|Y1003_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SaurJH9_1003
sp|Y1005_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SAV1005
sp|Y1022_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SaurJH1_1022
sp|Y863_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SA0863
sp|Y999_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=UPF0738 protein SAHV_0999


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
7 fig|158879.11.peg.920 GTP pyrophosphokinase (EC 2.7.6.5) ## RelQ = Bsu YjbM
6 fig|158879.11.peg.922 tRNA pseudouridine(32) synthase Yjbo


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search