The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.757: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Putative acetyltransferase YvoF
Translate Function Assignments



Context on contig NC_002745 from base 814934 to 826011 (11078 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
753 814934 817780 2847 +       1: 3   Excinuclease ABC subunit A gene_name|uvrA, locus|SA0714, protein_id|NP_373969.1, gi|15926436, geneID|1123521
754 818150 818049 102 - 268         hypothetical protein  
755 818444 819376 933 + 293     2: 8 7   HPr kinase/phosphorylase (EC 2.7.1.-) (EC 2.7.4.-) gene_name|hprK, locus|SA0715, protein_id|NP_373970.1, gi|15926437, geneID|1123522
756 819382 820221 840 + 5 4 2: 5 9 dlit(7592473) Prolipoprotein diacylglyceryl transferase gene_name|lgt, locus|SA0716, protein_id|NP_373971.1, gi|15926438, geneID|1123523
757 820229 820714 486 + 7       Putative acetyltransferase YvoF locus|SA0717, protein_id|NP_373972.1, gi|15926439, geneID|1123524
758 820722 822161 1440 + 7 5     TPR domain protein locus|SA0718, protein_id|NP_373973.1, gi|15926440, geneID|1123525
759 822228 823163 936 + 66     5: 10 4 11 6 2   Thioredoxin reductase (EC 1.8.1.9) gene_name|trxB, locus|SA0719, protein_id|NP_373974.1, gi|15926441, geneID|1123526
760 824108 825019 912 + 944 8 1: 1   RNase adapter protein RapZ locus|SA0720, protein_id|NP_373975.1, gi|15926442, geneID|1123527
761 825016 826011 996 + -4     1: 1   FIG002813: LPPG:FO 2-phospho-L-lactate transferase like, CofD-like locus|SA0721, protein_id|NP_373976.1, gi|15926443, geneID|1123528

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.757 Putative acetyltransferase YvoF
MRKFLSKTHHHTNPLWRVYRLVKFSKVFKNVIIIEFSKFIPSMVLKRHIYKQLLNINIGN
QSSIAYKVMLDIFYPELITIGSNSVIGYNVTILTHEALVDEFRYGPVTIGSNTLIGANAT
ILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMIRR

MD5 = 37089ca0a50fba9b842e98ad61d0e13c


  DNA Sequence

>fig|158879.11.peg.757 Putative acetyltransferase YvoF
ttgagaaaatttttatcaaaaacacatcatcatacaaaccctttatggcgtgtataccgt
cttgttaaattttcgaaagtttttaagaatgtaattatcattgaattttcgaaatttatt
ccaagtatggtactgaaaagacatatatataaacaacttttaaatattaatatcggtaat
caatcatcgatagcttataaagtaatgttagatattttttacccagaactgattacgatt
ggtagtaacagtgttattggttacaatgtaacaattttgacgcatgaagcattagttgat
gaatttcgttatggaccagtgacgataggatctaacactttgattggtgcaaatgctacc
attttacccggtataacgattggtgacaatgtaaaagttgcagctggtacggttgtttca
aaagatataccggataatggatttgcatatggcaaccctatgtatataaaaatgattagg
aggtga


  DNA with Flanking Sequence

>fig|158879.11.peg.757 Putative acetyltransferase YvoF
aaacccatttcaaattggtgatatcgttgcgccaagtataattttagcgcaaggaattgg
acgctggggtaactttatgaatcacgaggcacatggtggaccggtgtcacgcgctttttt
agaacaattacatttgcctaattttataatagaaaatatgtatattaacggccaatatta
tcatccaacattcttatatgaatccatttgggatgtcgctggatttattatcttagttaa
tattcgtaaacatttaaaattaggagaaacattctttttatatttaacttggtattcaat
tggtcgattctttatagaaggattacgtacagatagcttaatgctcacaagtaatattag
agttgcacaattagtatcaattcttttaattttaataagtataagtttaattgtatatag
aaggattaagtataatccaccgttgtatagcaaagttggggcgcttccatggccaacaaa
aaaagtgaagtagtgatattttgagaaaatttttatcaaaaacacatcatcatacaaacc
ctttatggcgtgtataccgtcttgttaaattttcgaaagtttttaagaatgtaattatca
ttgaattttcgaaatttattccaagtatggtactgaaaagacatatatataaacaacttt
taaatattaatatcggtaatcaatcatcgatagcttataaagtaatgttagatatttttt
acccagaactgattacgattggtagtaacagtgttattggttacaatgtaacaattttga
cgcatgaagcattagttgatgaatttcgttatggaccagtgacgataggatctaacactt
tgattggtgcaaatgctaccattttacccggtataacgattggtgacaatgtaaaagttg
cagctggtacggttgtttcaaaagatataccggataatggatttgcatatggcaacccta
tgtatataaaaatgattaggaggtgacaattttatggcgcaaaagaataataatgtaatt
ccaatgacttttgatgatgcattttatcgtaaaatggctaaacagaagtttaaacaaaga
gaatataaacgagctgctgaatactttgaaaaagtgttagaattgtcacctgatgatctg
gaaattcaaattgattatgcacaatgtctagtgcaacttggtattgctaaaaaagcagaa
catttattttatgacaatattatttataataggcatctagaagatagcttttatgaattg
agtcagctcaacattgaagttaacgaaccaaacaaggcattcttgtttggtattaattat
gttattgttagcgacgaccaagattatagagatgaattagatcaaatgtttgatgtgaaa
tatcaaagcgaagaacaaattgaacttgaagctcaattgtttgtagttcaaatactattc
caatatcttttttctcaaggtcgattaaaagatgcaaagaattatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008415       F:acyltransferase activity
GO:0016740       F:transferase activity
cmr|NT01SA0772 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA0762 Staphylococcus aureus Mu50     O-acetyltransferase
cmr|NT03SA0797 Staphylococcus aureus MW2     Bacterial transferase hexapeptide (four repeats)
cmr|NT09SA0736 Staphylococcus aureus subsp. aureus MSSA476     maltose O-acetyltransferase
cmr|SACOL0827 Staphylococcus aureus subsp. aureus COL     acetyltransferase, putative
cmr|SAUSA300_0745 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative acetyltransferase
dbj|BAB41950.1 Staphylococcus aureus subsp. aureus N315     SA0717
dbj|BAB56924.1 Staphylococcus aureus subsp. aureus Mu50     similar to O-acetyltransferase
dbj|BAB94589.1 Staphylococcus aureus subsp. aureus MW2     MW0724
dbj|BAF67002.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77642.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG42503.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative acetyltransferase
fig|158878.1.peg.762 Staphylococcus aureus subsp. aureus Mu50 FIG   Putative acetyltransferase YvoF
fig|158878.14.peg.780 Staphylococcus aureus subsp. aureus Mu50 FIG   Putative acetyltransferase YvoF
fig|158879.1.peg.733 Staphylococcus aureus subsp. aureus N315 FIG   Putative acetyltransferase YvoF
fig|196620.1.peg.724 Staphylococcus aureus subsp. aureus MW2 FIG   Putative acetyltransferase YvoF
fig|196620.5.peg.761 Staphylococcus aureus subsp. aureus MW2 FIG   Putative acetyltransferase YvoF
fig|282459.1.peg.722 Staphylococcus aureus subsp. aureus MSSA476 FIG   Putative acetyltransferase YvoF
fig|359786.13.peg.849 Staphylococcus aureus subsp. aureus JH9 FIG   Putative acetyltransferase YvoF
fig|359786.3.peg.698 Staphylococcus aureus subsp. aureus JH9 FIG   Putative acetyltransferase YvoF
fig|359787.11.peg.840 Staphylococcus aureus subsp. aureus JH1 FIG   Putative acetyltransferase YvoF
fig|359787.3.peg.2403 Staphylococcus aureus subsp. aureus JH1 FIG   Putative acetyltransferase YvoF
fig|367830.3.peg.2039 Staphylococcus aureus subsp. aureus USA300 FIG   Putative acetyltransferase YvoF
fig|418127.4.peg.713 Staphylococcus aureus subsp. aureus Mu3 FIG   Putative acetyltransferase YvoF
fig|418127.6.peg.776 Staphylococcus aureus subsp. aureus Mu3 FIG   Putative acetyltransferase YvoF
fig|426430.6.peg.716 Staphylococcus aureus subsp. aureus str. Newman FIG   Putative acetyltransferase YvoF
fig|426430.8.peg.787 Staphylococcus aureus subsp. aureus str. Newman FIG   Putative acetyltransferase YvoF
fig|450394.6.peg.1326 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Putative acetyltransferase YvoF
fig|451515.3.peg.824 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Putative acetyltransferase YvoF
fig|451516.9.peg.828 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Putative acetyltransferase YvoF
fig|452948.4.peg.1931 Staphylococcus aureus 930918-3 FIG   Putative acetyltransferase YvoF
fig|505321.3.peg.309 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Putative acetyltransferase YvoF
fig|546342.3.peg.2470 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Putative acetyltransferase YvoF
fig|546343.3.peg.1269 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Putative acetyltransferase YvoF
fig|548475.3.peg.1065 Staphylococcus aureus subsp. aureus TCH70 FIG   Putative acetyltransferase YvoF
fig|553565.3.peg.716 Staphylococcus aureus A5937 FIG   Putative acetyltransferase YvoF
fig|553567.3.peg.2472 Staphylococcus aureus A5948 FIG   Putative acetyltransferase YvoF
fig|553574.3.peg.2367 Staphylococcus aureus A8117 FIG   Putative acetyltransferase YvoF
fig|553580.3.peg.1629 Staphylococcus aureus A8819 FIG   Putative acetyltransferase YvoF
fig|553581.3.peg.455 Staphylococcus aureus A9299 FIG   Putative acetyltransferase YvoF
fig|553588.3.peg.1855 Staphylococcus aureus A9719 FIG   Putative acetyltransferase YvoF
fig|553590.4.peg.2537 Staphylococcus aureus A9754 FIG   Putative acetyltransferase YvoF
fig|553594.3.peg.1068 Staphylococcus aureus A9765 FIG   Putative acetyltransferase YvoF
fig|553596.3.peg.1826 Staphylococcus aureus A9781 FIG   Putative acetyltransferase YvoF
fig|553601.3.peg.349 Staphylococcus aureus A10102 FIG   Putative acetyltransferase YvoF
fig|644279.4.peg.850 Staphylococcus aureus subsp. aureus 132 FIG   Putative acetyltransferase YvoF
fig|680649.3.peg.2469 Staphylococcus aureus subsp. aureus MR1 FIG   Putative acetyltransferase YvoF
fig|681288.4.peg.726 Staphylococcus aureus subsp. aureus ED98 FIG   Putative acetyltransferase YvoF
fig|703339.3.peg.753 Staphylococcus aureus 04-02981 FIG   Putative acetyltransferase YvoF
fig|762962.3.peg.1217 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Putative acetyltransferase YvoF
fig|93061.3.peg.753 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative acetyltransferase YvoF
fig|93061.5.peg.704 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Putative acetyltransferase YvoF
fig|93062.19.peg.805 Staphylococcus aureus subsp. aureus COL FIG   Putative acetyltransferase YvoF
fig|93062.4.peg.313 Staphylococcus aureus subsp. aureus COL FIG   Putative acetyltransferase YvoF
gb|AAW36383.1 Staphylococcus aureus subsp. aureus COL     acetyltransferase, putative
gb|ABD22189.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative acetyltransferase
gb|ABD29912.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ48589.1 Staphylococcus aureus subsp. aureus JH9     transferase hexapeptide repeat containing protein
gb|ABR51659.1 Staphylococcus aureus subsp. aureus JH1     transferase hexapeptide repeat containing protein
gb|ABX28811.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible acetyltransferase
gb|EES55496.1 Staphylococcus aureus subsp. aureus TCH70     acetyltransferase
gb|EES93601.1 Staphylococcus aureus subsp. aureus USA300_TCH959     acetyltransferase
gb|EEV27229.1 Staphylococcus aureus A9781     acetyltransferase
gb|EEV63505.1 Staphylococcus aureus A9763     acetyltransferase
gb|EEV66880.1 Staphylococcus aureus A9719     acetyltransferase
gb|EEV73367.1 Staphylococcus aureus A9299     O-acetyltransferase
gb|EEV76381.1 Staphylococcus aureus A8115     transferase hexapeptide repeat containing protein
gb|EEV78290.1 Staphylococcus aureus A6300     transferase hexapeptide repeat containing protein
gb|EEV79994.1 Staphylococcus aureus A6224     acetyltransferase
gb|EEV82335.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV86608.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW44444.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_1864
gb|EEW46954.1 Staphylococcus aureus D30     hypothetical protein SAD30_0968
gi|13700653 Staphylococcus aureus subsp. aureus N315 NCBI   SA0717
gi|14246531 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to O-acetyltransferase
gi|147740291 Staphylococcus aureus subsp. aureus JH9 NCBI   transferase hexapeptide repeat containing protein
gi|148267222 Staphylococcus aureus subsp. aureus JH9 NCBI   hexapaptide repeat-containing transferase
gi|149945723 Staphylococcus aureus subsp. aureus JH1 NCBI   transferase hexapeptide repeat containing protein
gi|150373742 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150393271 Staphylococcus aureus subsp. aureus JH1 NCBI   hexapaptide repeat-containing transferase
gi|151220942 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0730
gi|156721225 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979090 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0759
gi|15923752 Staphylococcus aureus subsp. aureus Mu50 NCBI   O-acetyltransferase
gi|15926439 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0717
gi|160367840 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible acetyltransferase
gi|161509031 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   acetyltransferase
gi|21203890 Staphylococcus aureus subsp. aureus MW2 NCBI   MW0724
gi|21282453 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0724
gi|221139419 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   acetyltransferase
gi|221141244 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   acetyltransferase
gi|251802839 Staphylococcus aureus subsp. aureus TCH70 NCBI   acetyltransferase
gi|251813733 Staphylococcus aureus subsp. aureus TCH70 NCBI   acetyltransferase
gi|253314855 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   putative acetyltransferase
gi|253724872 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   acetyltransferase
gi|253731391 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   acetyltransferase
gi|255005553 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   putative acetyltransferase
gi|257788889 Staphylococcus aureus A9781 NCBI   acetyltransferase
gi|257794917 Staphylococcus aureus A9781 NCBI   acetyltransferase
gi|257839026 Staphylococcus aureus A9763 NCBI   acetyltransferase
gi|257842456 Staphylococcus aureus A9719 NCBI   acetyltransferase
gi|257849397 Staphylococcus aureus A9299 NCBI   O-acetyltransferase
gi|257852460 Staphylococcus aureus A8115 NCBI   transferase hexapeptide repeat containing protein
gi|257855352 Staphylococcus aureus A6300 NCBI   transferase hexapeptide repeat containing protein
gi|257857095 Staphylococcus aureus A6224 NCBI   acetyltransferase
gi|257859481 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257863852 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418233 Staphylococcus aureus A9763 NCBI   acetyltransferase
gi|258421530 Staphylococcus aureus A9719 NCBI   acetyltransferase
gi|258430725 Staphylococcus aureus A9299 NCBI   O-acetyltransferase
gi|258440946 Staphylococcus aureus A8115 NCBI   transferase hexapeptide repeat containing protein
gi|258445776 Staphylococcus aureus A6300 NCBI   transferase hexapeptide repeat containing protein
gi|258449587 Staphylococcus aureus A6224 NCBI   acetyltransferase
gi|258452970 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258453987 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259159391 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_1864
gi|259162382 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0968
gi|49244077 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative acetyltransferase
gi|49485634 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative acetyltransferase
gi|57284289 Staphylococcus aureus subsp. aureus COL NCBI   acetyltransferase, putative
gi|57650103 Staphylococcus aureus subsp. aureus COL NCBI   acetyltransferase, putative
gi|81170380 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative acetyltransferase SACOL0827
gi|81170381 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative acetyltransferase SAV0762
gi|81170382 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative acetyltransferase SA0717
gi|81170384 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative acetyltransferase SAS0727
gi|81170385 organism not parsed/found in ncbi nr NCBI   RecName: Full=Putative acetyltransferase MW0724
gi|87127675 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative acetyltransferase
gi|87161701 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative acetyltransferase
gi|87202102 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88194544 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00783
img|637092349 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099276 Staphylococcus aureus aureus Mu50 IMG   similar to O-acetyltransferase
img|637151597 Staphylococcus aureus aureus COL IMG   acetyltransferase, putative
img|637156955 Staphylococcus aureus aureus MSSA476 IMG   putative acetyltransferase
img|637298484 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637887398 Staphylococcus aureus aureus USA300 IMG   putative acetyltransferase
img|637893430 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108076 Staphylococcus aureus aureus JH1 IMG   transferase hexapeptide repeat
img|640565136 Staphylococcus aureus aureus JH9 IMG   transferase hexapeptide repeat containing protein
img|640778888 Staphylococcus aureus aureus JH1 IMG   transferase hexapeptide repeat containing protein
img|640795106 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640903498 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308757 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible acetyltransferase( EC:2.3.1.- )
img|641771567 Staphylococcus aureus aureus USA300_TCH959 IMG   possible acetyltransferase
kegg|saa:SAUSA300_0745 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   putative acetyltransferase
kegg|sac:SACOL0827 Staphylococcus aureus subsp. aureus COL KEGG   acetyltransferase, putative
kegg|sae:NWMN_0730 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0803 Staphylococcus aureus subsp. aureus JH1 KEGG   hexapaptide repeat-containing transferase
kegg|saj:SaurJH9_0786 Staphylococcus aureus subsp. aureus JH9 KEGG   hexapaptide repeat-containing transferase
kegg|sam:MW0724 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00783 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS0727   KEGG   putative acetyltransferase
kegg|sau:SA0717   KEGG   hypothetical protein
kegg|sav:SAV0762   KEGG   O-acetyltransferase
kegg|saw:SAHV_0759 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0790 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   acetyltransferase (EC:2.3.1.-)
ref|NP_371286.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   O-acetyltransferase
ref|NP_373972.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0717
ref|NP_645541.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0724
ref|YP_001246165.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hexapaptide repeat-containing transferase
ref|YP_001315946.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hexapaptide repeat-containing transferase
ref|YP_001331764.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0730
ref|YP_001441349.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0759
ref|YP_001574690.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   acetyltransferase
ref|YP_042855.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative acetyltransferase
ref|YP_185701.1 Staphylococcus aureus subsp. aureus COL RefSeq   acetyltransferase, putative
ref|YP_493447.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   putative acetyltransferase
ref|YP_499340.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00783
ref|ZP_03564218.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   acetyltransferase
ref|ZP_03565737.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   acetyltransferase
ref|ZP_04828206.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   acetyltransferase
ref|ZP_04838068.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   putative acetyltransferase
ref|ZP_04865556.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   acetyltransferase
ref|ZP_05144154.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   putative acetyltransferase
ref|ZP_05643896.1 Staphylococcus aureus A9781 RefSeq   acetyltransferase
ref|ZP_05682498.1 Staphylococcus aureus A9763 RefSeq   acetyltransferase
ref|ZP_05684455.1 Staphylococcus aureus A9719 RefSeq   acetyltransferase
ref|ZP_05688437.1 Staphylococcus aureus A9299 RefSeq   O-acetyltransferase
ref|ZP_05690781.1 Staphylococcus aureus A8115 RefSeq   transferase hexapeptide repeat containing protein
ref|ZP_05693953.1 Staphylococcus aureus A6300 RefSeq   transferase hexapeptide repeat containing protein
ref|ZP_05697689.1 Staphylococcus aureus A6224 RefSeq   acetyltransferase
ref|ZP_05700964.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05701959.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
sp|ATRF1_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative acetyltransferase SACOL0827
sp|ATRF1_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative acetyltransferase SAV0762
sp|ATRF1_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative acetyltransferase SA0717
sp|ATRF1_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative acetyltransferase SAS0727
sp|ATRF1_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Putative acetyltransferase MW0724
sp|Q5HHQ6 Staphylococcus aureus (strain COL) SwissProt   Putative acetyltransferase SACOL0827
sp|Q6GB68 Staphylococcus aureus (strain MSSA476) SwissProt   Putative acetyltransferase SAS0727
sp|Q7A1G0 Staphylococcus aureus (strain MW2) SwissProt   Putative acetyltransferase MW0724
sp|Q7A6Q9 Staphylococcus aureus (strain N315) SwissProt   Putative acetyltransferase SA0717
sp|Q99VL4 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Putative acetyltransferase SAV0762
tr|A5IQW6 Staphylococcus aureus (strain JH9) TrEMBL   Transferase hexapeptide repeat containing protein
tr|A6QF70 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TZP1 Staphylococcus aureus (strain JH1) TrEMBL   Transferase hexapeptide repeat containing protein
tr|A7WZR1 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8Z038 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible acetyltransferase
tr|C5N3L4 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Acetyltransferase
tr|C5QHE0 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Acetyltransferase
tr|Q2FIN1 Staphylococcus aureus (strain USA300) TrEMBL   Putative acetyltransferase
tr|Q2G043 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|158879.11.peg.756 Prolipoprotein diacylglyceryl transferase
5 fig|158879.11.peg.758 TPR domain protein
8 fig|158879.11.peg.760 RNase adapter protein RapZ


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search