The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.744: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: ComF operon protein A, DNA transporter ATPase
Translate Function Assignments



Context on contig NC_002745 from base 798035 to 810367 (12333 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
739 798796 798035 762 -           YjjP-like membrane protein SAV0745 locus|SA0700, protein_id|NP_373955.1, gi|15926422, geneID|1123507
740 800062 798992 1071 - 195         GGDEF domain-containing protein locus|SA0701, protein_id|NP_373956.1, gi|15926423, geneID|1123508
741 800380 801435 1056 + 317 6 3: 13 10 16 dlit(16740924) Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.33) gene_name|llm, locus|SA0702, protein_id|NP_373957.1, gi|15926424, geneID|1123509
742 802241 801600 642 - 164 18 2: 9 17   IMPACT family member YigZ locus|SA0703, protein_id|NP_373958.1, gi|15926425, geneID|1123510
743 802385 803251 867 + 143 6     FIG005590: DegV family protein locus|SA0704, protein_id|NP_373959.1, gi|15926426, geneID|1123511
744 803615 804697 1083 + 363   2: 1 2   ComF operon protein A, DNA transporter ATPase locus|SA0705, protein_id|NP_373960.1, gi|15926427, geneID|1123512
745 804690 805364 675 + -8 16 2: 1 2   DNA utilization protein YhgH locus|SA0706, protein_id|NP_373961.1, gi|15926428, geneID|1123513
746 805425 805997 573 + 60 8 2: 14 6 dlit(27001516) Ribosome hibernation promoting factor Hpf locus|SA0707, protein_id|NP_373962.1, gi|15926429, geneID|1123514
747 806411 808942 2532 + 413 9 3: 8 12 3   Protein translocase subunit SecA gene_name|secA, locus|SA0708, protein_id|NP_373963.1, gi|15926430, geneID|1123515
748 809375 810367 993 + 432 9 6: 5 4 15 11 7 3   Peptide chain release factor 2; programmed frameshift-containing gene_name|prfB, locus|SA0709, protein_id|NP_373964.1, gi|15926431, geneID|1123516

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Gram_Positive_Competence RamyA ComF operon protein A, DNA transporter ATPase
Late_competence VeronikaV ComF operon protein A, DNA transporter ATPase


  Protein Sequence

>fig|158879.11.peg.744 ComF operon protein A, DNA transporter ATPase
MDNVTRYKITESSQSSSQAYYHLSFELSEQQSYASEHIVRAIRMRQTILLYAVTGAGKTE
MMFQGIQYARRQGDNIAIVSPRVDVVVEISKRIKDAFLNEDIDILHQQSSQQFEGHFVVC
TVHQLYRFKQHFDTIFIDEVDAFPLSMDKSLQQALKSSSKVEHATIYMTATPPKQLLSEI
PHENIIKLPARFHKKSLPVPKYRYFKLNNNKIQKMLYRILQDQINNQRYTLVFFNNIETM
IKTFSVYKQKITKLTYVHSEDVFRFEKVEQLRNGHFDVIFTTTILERGFTMANLDVVVID
AHQYTQEALIQIAGRVGRKLECPAGKVLFFHEGVSMNMIQAKKEIQRMNKLALKRGWIDE

MD5 = 29d7d22db60c649d57cfb437bb57aa6e


  DNA Sequence

>fig|158879.11.peg.744 ComF operon protein A, DNA transporter ATPase
atggataatgtaacaagatataaaataacagagagttcgcaaagttcatcacaagcatat
tatcatctctcatttgaattgtcggaacagcagtcttatgcctcagaacatattgttcga
gccattagaatgagacaaacgattttgttatatgccgtaacaggtgcaggtaagacagaa
atgatgtttcaaggcattcaatatgcaagacgacagggagataatatagctattgtgtca
ccgcgtgtagatgttgttgtagaaattagtaaacgtattaaagacgcatttcttaatgaa
gatatagacatactacaccagcaatcaagtcaacaatttgaagggcattttgttgtatgc
acagtacatcaactttaccgattcaaacagcactttgatactatttttattgatgaagtc
gatgcctttcctttatcaatggataaaagtttacaacaagcattgaagtcatcttctaaa
gttgaacatgcaacgatttatatgacagcaacaccaccgaaacaacttctgtcagagatt
ccccacgaaaatataattaaattgccagctcgctttcataaaaaatcacttccagttcct
aaatatcgttatttcaaacttaataataataagattcagaaaatgttataccgaatttta
caagatcaaattaataatcaacgttatacactggtgttttttaacaatatagaaacaatg
attaaaacattttcggtttataagcagaaaattactaaattaacatacgtccatagcgag
gatgtttttcgctttgaaaaagttgaacaattaaggaatggacatttcgatgtcattttt
actacgacaatattagaacgtggatttacaatggcaaatttggatgttgttgttatcgat
gcacatcaatatactcaagaggctttaatacaaattgctggacgtgttggacgaaaatta
gaatgtcctgctggaaaagtattgttttttcatgaaggagtaagtatgaatatgattcaa
gctaaaaaagagattcaaaggatgaacaaattagcattaaaaagaggttggattgatgaa
taa


  DNA with Flanking Sequence

>fig|158879.11.peg.744 ComF operon protein A, DNA transporter ATPase
tatacaaaaagttacaagaagattgtccttcaggttatcaagtagcatactctgagtttg
gtccagttgttgcagcacatttaggttctggtggattaggtttaggctatgttggcagaa
aaataagattaacataattataaaattttaataaaagagtctatattgtaattggaaatt
atctctcgtatacatggctttaaatgttcatcatttgaaagtcaaaatgctaaagatata
agaaaatcattataatattaggctcttttttacgttgaaatgaggttttaagcattaaac
attacgggaaattaattcatcctcatacttcacttactaatgaaaaaataaaaaaagaag
taacaggtgtcatcaaacaaaattcaaactattattgtgttcaatgtgaaagtacaaatc
caaagcatttttatcagtatgattcctcagtacattccaagaaaattgtatattgcagaa
attgtatatcactgggtcgaatggataatgtaacaagatataaaataacagagagttcgc
aaagttcatcacaagcatattatcatctctcatttgaattgtcggaacagcagtcttatg
cctcagaacatattgttcgagccattagaatgagacaaacgattttgttatatgccgtaa
caggtgcaggtaagacagaaatgatgtttcaaggcattcaatatgcaagacgacagggag
ataatatagctattgtgtcaccgcgtgtagatgttgttgtagaaattagtaaacgtatta
aagacgcatttcttaatgaagatatagacatactacaccagcaatcaagtcaacaatttg
aagggcattttgttgtatgcacagtacatcaactttaccgattcaaacagcactttgata
ctatttttattgatgaagtcgatgcctttcctttatcaatggataaaagtttacaacaag
cattgaagtcatcttctaaagttgaacatgcaacgatttatatgacagcaacaccaccga
aacaacttctgtcagagattccccacgaaaatataattaaattgccagctcgctttcata
aaaaatcacttccagttcctaaatatcgttatttcaaacttaataataataagattcaga
aaatgttataccgaattttacaagatcaaattaataatcaacgttatacactggtgtttt
ttaacaatatagaaacaatgattaaaacattttcggtttataagcagaaaattactaaat
taacatacgtccatagcgaggatgtttttcgctttgaaaaagttgaacaattaaggaatg
gacatttcgatgtcatttttactacgacaatattagaacgtggatttacaatggcaaatt
tggatgttgttgttatcgatgcacatcaatatactcaagaggctttaatacaaattgctg
gacgtgttggacgaaaattagaatgtcctgctggaaaagtattgttttttcatgaaggag
taagtatgaatatgattcaagctaaaaaagagattcaaaggatgaacaaattagcattaa
aaagaggttggattgatgaataattgtttgagttgtggtgctaagttatatgaaaatata
accatttataatttgttcaagaaacctaatagattatgtgacagatgcaaagagaattgg
gacaatattaaacttgatattaaagcaaggcgatgttcaaggtgcttaaaacacttaaat
caagatgaagcgtattgtttagactgcaagtttctatcggcacactttaatttaatggaa
caattatattgtcaatttcaatatgacggtttaatgaaagagatgatacatcagtataaa
tttttgaaagactattatttatgtgaattattggcacatttgattgaaataccacaaaca
tcttatgactatattgtgccaattccttcttcgccggcacatgatttatctagaacattt
aacccggtagaagcagtactaaaagctaaagggattcgctttgataagattttaaagatg
tcaaatagaccaaaacagtctcatttaactaagaaagagcgtc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0004386       F:helicase activity
GO:0005524       F:ATP binding
fig|158878.1.peg.2808 Staphylococcus aureus subsp. aureus Mu50 FIG   ComF operon protein A, DNA transporter ATPase
fig|158879.1.peg.2678 Staphylococcus aureus subsp. aureus N315 FIG   ComF operon protein A, DNA transporter ATPase
fig|359786.13.peg.836 Staphylococcus aureus subsp. aureus JH9 FIG   ComF operon protein A, DNA transporter ATPase
fig|359786.3.peg.1296 Staphylococcus aureus subsp. aureus JH9 FIG   ComF operon protein A, DNA transporter ATPase
fig|359787.11.peg.827 Staphylococcus aureus subsp. aureus JH1 FIG   ComF operon protein A, DNA transporter ATPase
fig|359787.3.peg.2385 Staphylococcus aureus subsp. aureus JH1 FIG   ComF operon protein A, DNA transporter ATPase
fig|418127.4.peg.702 Staphylococcus aureus subsp. aureus Mu3 FIG   ComF operon protein A, DNA transporter ATPase
fig|418127.6.peg.763 Staphylococcus aureus subsp. aureus Mu3 FIG   ComF operon protein A, DNA transporter ATPase
fig|553565.3.peg.729 Staphylococcus aureus A5937 FIG   ComF operon protein A, DNA transporter ATPase
fig|553568.3.peg.1926 Staphylococcus aureus A6224 FIG   ComF operon protein A, DNA transporter ATPase
fig|553571.3.peg.820 Staphylococcus aureus A6300 FIG   ComF operon protein A, DNA transporter ATPase
fig|553573.3.peg.456 Staphylococcus aureus A8115 FIG   ComF operon protein A, DNA transporter ATPase
fig|553574.3.peg.1854 Staphylococcus aureus A8117 FIG   ComF operon protein A, DNA transporter ATPase
fig|553577.3.peg.1271 Staphylococcus aureus A8796 FIG   ComF operon protein A, DNA transporter ATPase
fig|553580.3.peg.1616 Staphylococcus aureus A8819 FIG   ComF operon protein A, DNA transporter ATPase
fig|553581.3.peg.468 Staphylococcus aureus A9299 FIG   ComF operon protein A, DNA transporter ATPase
fig|553588.3.peg.1868 Staphylococcus aureus A9719 FIG   ComF operon protein A, DNA transporter ATPase
fig|553592.3.peg.2578 Staphylococcus aureus A9763 FIG   ComF operon protein A, DNA transporter ATPase
fig|553596.3.peg.1839 Staphylococcus aureus A9781 FIG   ComF operon protein A, DNA transporter ATPase
fig|553601.3.peg.337 Staphylococcus aureus A10102 FIG   ComF operon protein A, DNA transporter ATPase
fig|703339.3.peg.740 Staphylococcus aureus 04-02981 FIG   ComF operon protein A, DNA transporter ATPase
gb|ABQ48577.1 Staphylococcus aureus subsp. aureus JH9     helicase domain protein
gb|ABR51647.1 Staphylococcus aureus subsp. aureus JH1     helicase domain protein
gb|EEV27241.1 Staphylococcus aureus A9781     helicase
gb|EEV63517.1 Staphylococcus aureus A9763     helicase
gb|EEV66892.1 Staphylococcus aureus A9719     helicase domain-containing protein
gb|EEV73379.1 Staphylococcus aureus A9299     helicase domain-containing protein
gb|EEV76167.1 Staphylococcus aureus A8115     helicase domain-containing protein
gb|EEV78302.1 Staphylococcus aureus A6300     helicase domain-containing protein
gb|EEV80006.1 Staphylococcus aureus A6224     helicase domain-containing protein
gb|EEV86620.1 Staphylococcus aureus A5937     helicase domain-containing protein
gi|147740279 Staphylococcus aureus subsp. aureus JH9 NCBI   helicase domain protein
gi|148267210 Staphylococcus aureus subsp. aureus JH9 NCBI   helicase domain-containing protein
gi|149945711 Staphylococcus aureus subsp. aureus JH1 NCBI   helicase domain protein
gi|150393259 Staphylococcus aureus subsp. aureus JH1 NCBI   helicase domain-containing protein
gi|253315816 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   helicase domain-containing protein
gi|255005541 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   helicase domain-containing protein
gi|257788901 Staphylococcus aureus A9781 NCBI   helicase
gi|257794929 Staphylococcus aureus A9781 NCBI   helicase
gi|257839038 Staphylococcus aureus A9763 NCBI   helicase
gi|257842468 Staphylococcus aureus A9719 NCBI   helicase domain-containing protein
gi|257849409 Staphylococcus aureus A9299 NCBI   helicase domain-containing protein
gi|257852240 Staphylococcus aureus A8115 NCBI   helicase domain-containing protein
gi|257855364 Staphylococcus aureus A6300 NCBI   helicase domain-containing protein
gi|257857107 Staphylococcus aureus A6224 NCBI   helicase domain-containing protein
gi|257863864 Staphylococcus aureus A5937 NCBI   helicase domain-containing protein
gi|258418245 Staphylococcus aureus A9763 NCBI   helicase
gi|258421542 Staphylococcus aureus A9719 NCBI   helicase domain-containing protein
gi|258430737 Staphylococcus aureus A9299 NCBI   helicase domain-containing protein
gi|258441771 Staphylococcus aureus A8115 NCBI   helicase domain-containing protein
gi|258445788 Staphylococcus aureus A6300 NCBI   helicase domain-containing protein
gi|258449599 Staphylococcus aureus A6224 NCBI   helicase domain-containing protein
gi|258453999 Staphylococcus aureus A5937 NCBI   helicase domain-containing protein
img|639108064 Staphylococcus aureus aureus JH1 IMG   Helicase, C-terminal:Type III restriction enzyme, res subunit:DEAD/DEAH box helicase, N-terminal
img|640565124 Staphylococcus aureus aureus JH9 IMG   helicase domain protein
img|640778876 Staphylococcus aureus aureus JH1 IMG   helicase domain protein
kegg|sah:SaurJH1_0791 Staphylococcus aureus subsp. aureus JH1 KEGG   helicase domain-containing protein
kegg|saj:SaurJH9_0774 Staphylococcus aureus subsp. aureus JH9 KEGG   helicase domain-containing protein
ref|YP_001246153.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   helicase domain-containing protein
ref|YP_001315934.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   helicase domain-containing protein
ref|ZP_04839029.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   helicase domain-containing protein
ref|ZP_05144142.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   helicase domain-containing protein
ref|ZP_05643908.1 Staphylococcus aureus A9781 RefSeq   helicase
ref|ZP_05682510.1 Staphylococcus aureus A9763 RefSeq   helicase
ref|ZP_05684467.1 Staphylococcus aureus A9719 RefSeq   helicase domain-containing protein
ref|ZP_05688449.1 Staphylococcus aureus A9299 RefSeq   helicase domain-containing protein
ref|ZP_05691043.1 Staphylococcus aureus A8115 RefSeq   helicase domain-containing protein
ref|ZP_05693965.1 Staphylococcus aureus A6300 RefSeq   helicase domain-containing protein
ref|ZP_05697701.1 Staphylococcus aureus A6224 RefSeq   helicase domain-containing protein
ref|ZP_05701971.1 Staphylococcus aureus A5937 RefSeq   helicase domain-containing protein
tr|A5IQV4 Staphylococcus aureus (strain JH9) TrEMBL   Helicase domain protein
tr|A6TZM9 Staphylococcus aureus (strain JH1) TrEMBL   Helicase domain protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
6 fig|158879.11.peg.741 Undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.33)
18 fig|158879.11.peg.742 IMPACT family member YigZ
6 fig|158879.11.peg.743 FIG005590: DegV family protein
16 fig|158879.11.peg.745 DNA utilization protein YhgH
8 fig|158879.11.peg.746 Ribosome hibernation promoting factor Hpf
9 fig|158879.11.peg.747 Protein translocase subunit SecA
9 fig|158879.11.peg.748 Peptide chain release factor 2; programmed frameshift-containing


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search