The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.622: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: FIG01108264: hypothetical protein
Translate Function Assignments



Context on contig NC_002745 from base 678300 to 690110 (11811 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
617 679619 678300 1320 -           Mobile element protein locus|SA0586, protein_id|NP_373840.1, gi|15926307, geneID|1123392
618 681668 680739 930 - 1119         Manganese/zinc ABC transporter (EC 7.2.2.5), substrate-binding protein ScaA locus|SA0587, protein_id|NP_373841.1, gi|15926308, geneID|1123393
619 682501 681665 837 - -4         Manganese/zinc ABC transporter (EC 7.2.2.5), permease protein ScaB locus|SA0588, protein_id|NP_373842.1, gi|15926309, geneID|1123394
620 683238 682495 744 - -7         Manganese/zinc ABC transporter (EC 7.2.2.5), ATP-binding protein ScaC locus|SA0589, protein_id|NP_373843.1, gi|15926310, geneID|1123395
621 683360 684004 645 + 121         Mn-dependent transcriptional regulator MntR locus|SA0590, protein_id|NP_373844.1, gi|15926311, geneID|1123396
622 684836 684084 753 - 79         FIG01108264: hypothetical protein locus|SA0591, protein_id|NP_373845.1, gi|15926312, geneID|1123397
623 685072 685836 765 + 235     1: 1 dlit(10754251) N-acetylmannosaminyltransferase (EC 2.4.1.187) gene_name|tagA, locus|SA0592, protein_id|NP_373846.1, gi|15926313, geneID|1123398
624 686691 685897 795 - 60     2: 1 2   Teichoic acid export ATP-binding protein TagH (EC 3.6.3.40) gene_name|tagH, locus|SA0593, protein_id|NP_373847.1, gi|15926314, geneID|1123399
625 687038 687850 813 + 346     2: 1 2   Teichoic acid translocation permease protein TagG gene_name|tagG, locus|SA0594, protein_id|NP_373848.1, gi|15926315, geneID|1123400
626 688003 689052 1050 + 152     1: 1   CDP-glycerol: N-acetyl-beta-D-mannosaminyl-1,4-N-acetyl-D-glucosaminyldiphosphoundecaprenyl glycerophosphotransferase gene_name|tagB, locus|SA0595, protein_id|NP_373849.1, gi|15926316, geneID|1123401
627 689049 690110 1062 + -4     1: 1   Teichoic acid biosynthesis protein X gene_name|tagX, locus|SA0596, protein_id|NP_373850.1, gi|15926317, geneID|1123402

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.622 FIG01108264: hypothetical protein
MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVILNYIPVLTHEFGHVLF
NKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTIGGYLMPPIMLLIGLAS
SHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYFILKDENIVEIQLLVTMS
YQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHVPIFIYSTIWIIFNLYAVN
ILLKYTHLIN

MD5 = ab9b7bc58974b4ab8822e988ad31ae6f


  DNA Sequence

>fig|158879.11.peg.622 FIG01108264: hypothetical protein
atgaattatttatcaaacttttttaatacgacaattcaacttaatatatacattatcgtt
attgttgcagcttgttatattgctattcatcaatatagacataagcctgttttgaactat
ttagatgtcattttaaactatatccctgttttaacacatgaatttggtcatgtactgttt
aataaactcgctggtggccgtgcaaaagatttagtcattgtaacaagtccacgagagcga
caacagacattacaacaaggattcgcaattacacaatctagacatctagcaggccaatgg
cttacaacgattggtggttatttaatgccacctattatgttattgataggtttagcgtcg
agccattatcagatacctagtttctttatatttacctatttattgatatttatttatttt
ttaattttaacatctagaaaaggctcacccattgttgttataactttaatttctatcatg
ttgtattttatattaaaagatgaaaatatagtagaaattcaactacttgtcacaatgagt
tatcaatatattttaggtgtattattaggcgaagttctacaatctagttggacgattgct
aaattgactttccagcgtccgagtccacagtgggatggtagtgcacttaaagaactcagt
catgtacctatcttcatttatagtacaatctggattatcttcaatctttatgcagtgaat
attttactcaaatatactcacttgataaattaa


  DNA with Flanking Sequence

>fig|158879.11.peg.622 FIG01108264: hypothetical protein
gttgctttaaacgatgcgaagctttgactactcctgtcccatcagcaacaatatagctcg
cttgatttattaactctaaatacgcttgatgtgtcgtcgcgtaattcactatttcagggt
tggctgttactataaaaagattattcgttgattgatttgcaaaaaaggttttaatatttt
caaccatttgcaacattgttgtattatcaaaatcgacccctaaaatgtcaactttggctg
tattggatctttcttcaacagtcataacaggaatctcctatcttatttcattattatgtt
agtgtaatcaatattaacagtatttatattcatcctatttatatcgaaatgattttgctt
tattttaacacatattcaccttttcaaaaattaaaattagtttaactaaggtaagtctaa
agtctaacgctattgatgccaatatcatttataataagtgctaagcaaactttaaattaa
tatcttatatgaggttaacaatgaattatttatcaaacttttttaatacgacaattcaac
ttaatatatacattatcgttattgttgcagcttgttatattgctattcatcaatatagac
ataagcctgttttgaactatttagatgtcattttaaactatatccctgttttaacacatg
aatttggtcatgtactgtttaataaactcgctggtggccgtgcaaaagatttagtcattg
taacaagtccacgagagcgacaacagacattacaacaaggattcgcaattacacaatcta
gacatctagcaggccaatggcttacaacgattggtggttatttaatgccacctattatgt
tattgataggtttagcgtcgagccattatcagatacctagtttctttatatttacctatt
tattgatatttatttattttttaattttaacatctagaaaaggctcacccattgttgtta
taactttaatttctatcatgttgtattttatattaaaagatgaaaatatagtagaaattc
aactacttgtcacaatgagttatcaatatattttaggtgtattattaggcgaagttctac
aatctagttggacgattgctaaattgactttccagcgtccgagtccacagtgggatggta
gtgcacttaaagaactcagtcatgtacctatcttcatttatagtacaatctggattatct
tcaatctttatgcagtgaatattttactcaaatatactcacttgataaattaactaataa
aaaagaagcctaaagcaattatccatatgtctttatcagttcaatcatggatatctttat
ggcttctttattttatttttcagcaaacatgttcattgcattttcgtaactgacaataat
tacattatcattacgtttaatgataattactttattcatttcatctttcgatacaatttc
cacttcattaccaatagaaatatctttactagacaaatatattagcaaatcggtcttatc
tctcacacgtttgattgtaacgatatcaccaggttcataattcaaaatcgttgttatata
tttctctttatattcattatttctaggaatcacaccgccgtgcgggcaagtttctgggaa
atttaacaggctatccagcctttcaacaaataaatctgaaattcgatgttctaaaatttc
tgcttcttgatgtacttcttcccaattatatttcaatatttctattaaaaataattctaa
tagtcgatgtctc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0639 Staphylococcus aureus N315     membrane protein, putative
cmr|NT02SA0639 Staphylococcus aureus Mu50     membrane protein, putative
cmr|NT03SA0660 Staphylococcus aureus MW2     membrane protein, putative
cmr|NT09SA0612 Staphylococcus aureus subsp. aureus MSSA476     membrane protein, putative
dbj|BAB41823.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB56797.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB94462.1 Staphylococcus aureus subsp. aureus MW2     hypothetical protein
dbj|BAF77515.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG42376.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|158878.1.peg.635 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108264: hypothetical protein
fig|158878.14.peg.644 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108264: hypothetical protein
fig|158879.1.peg.606 Staphylococcus aureus subsp. aureus N315 FIG   FIG01108264: hypothetical protein
fig|196620.1.peg.597 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108264: hypothetical protein
fig|196620.5.peg.630 Staphylococcus aureus subsp. aureus MW2 FIG   FIG01108264: hypothetical protein
fig|282459.1.peg.595 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108264: hypothetical protein
fig|282459.5.peg.627 Staphylococcus aureus subsp. aureus MSSA476 FIG   FIG01108264: hypothetical protein
fig|359786.13.peg.713 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108264: hypothetical protein
fig|359786.3.peg.2466 Staphylococcus aureus subsp. aureus JH9 FIG   FIG01108264: hypothetical protein
fig|359787.11.peg.703 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108264: hypothetical protein
fig|359787.3.peg.714 Staphylococcus aureus subsp. aureus JH1 FIG   FIG01108264: hypothetical protein
fig|418127.4.peg.593 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108264: hypothetical protein
fig|418127.6.peg.641 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108264: hypothetical protein
fig|505321.3.peg.30 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108264: hypothetical protein
fig|548475.3.peg.934 Staphylococcus aureus subsp. aureus TCH70 FIG   FIG01108264: hypothetical protein
fig|553565.3.peg.849 Staphylococcus aureus A5937 FIG   FIG01108264: hypothetical protein
fig|553568.3.peg.2047 Staphylococcus aureus A6224 FIG   FIG01108264: hypothetical protein
fig|553571.3.peg.946 Staphylococcus aureus A6300 FIG   FIG01108264: hypothetical protein
fig|553573.3.peg.333 Staphylococcus aureus A8115 FIG   FIG01108264: hypothetical protein
fig|553574.3.peg.1733 Staphylococcus aureus A8117 FIG   FIG01108264: hypothetical protein
fig|553577.3.peg.2572 Staphylococcus aureus A8796 FIG   FIG01108264: hypothetical protein
fig|553580.3.peg.2553 Staphylococcus aureus A8819 FIG   FIG01108264: hypothetical protein
fig|553581.3.peg.590 Staphylococcus aureus A9299 FIG   FIG01108264: hypothetical protein
fig|553588.3.peg.304 Staphylococcus aureus A9719 FIG   FIG01108264: hypothetical protein
fig|553592.3.peg.2700 Staphylococcus aureus A9763 FIG   FIG01108264: hypothetical protein
fig|553596.3.peg.2018 Staphylococcus aureus A9781 FIG   FIG01108264: hypothetical protein
fig|553601.3.peg.216 Staphylococcus aureus A10102 FIG   FIG01108264: hypothetical protein
fig|585891.3.peg.643 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108264: hypothetical protein
fig|680649.3.peg.18 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108264: hypothetical protein
fig|703339.3.peg.619 Staphylococcus aureus 04-02981 FIG   FIG01108264: hypothetical protein
fig|762962.3.peg.1346 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   FIG01108264: hypothetical protein
gb|ABQ48461.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_0658
gb|ABR51530.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EES55503.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EEV27413.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV63632.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV68450.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV73492.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV76053.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV78421.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV80119.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV86734.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|13700526 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14246404 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147740163 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0658
gi|148267094 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0658
gi|149945594 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150393142 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0673
gi|156721098 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978963 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0632
gi|15923625 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0635
gi|15926312 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0591
gi|21203763 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein
gi|21282326 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW0597
gi|251802846 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251813600 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253314590 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00155
gi|255005428 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_03135
gi|257789073 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795101 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257839153 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257844059 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257849522 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257852126 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257855483 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257857220 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257863978 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258418360 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258419976 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258430850 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258441657 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258445907 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449712 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258454113 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|49243950 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49485507 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS0601
img|637092222 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099149 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637156828 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637298357 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|639109717 Staphylococcus aureus aureus JH1 IMG   putative membrane protein
img|640565008 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640778759 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640903371 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_0673 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0658 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW0597 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sas:SAS0601   KEGG   hypothetical protein
kegg|sau:SA0591   KEGG   hypothetical protein
kegg|sav:SAV0635   KEGG   hypothetical protein
kegg|saw:SAHV_0632 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371159.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0635
ref|NP_373845.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0591
ref|NP_645414.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW0597
ref|YP_001246037.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0658
ref|YP_001315817.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0673
ref|YP_001441222.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0632
ref|YP_042728.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS0601
ref|ZP_04828073.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04837803.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00155
ref|ZP_05144029.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_03135
ref|ZP_05644080.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05682625.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05682934.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05688562.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05690929.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05694084.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697814.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05702085.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IQI8 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6TZB2 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7WZ93 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C5QH07 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q6GBJ5 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q7A1M4 Staphylococcus aureus (strain MW2) TrEMBL   Putative uncharacterized protein MW0597
tr|Q7A715 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0591
tr|Q99VY0 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search