The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.596: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: endonuclease III domain protein
Translate Function Assignments



Context on contig NC_002745 from base 653214 to 665138 (11925 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
591 653214 654509 1296 +       2: 6 4   dNTP triphosphohydrolase, broad substrate specificity locus|SA0560, protein_id|NP_373814.1, gi|15926281, geneID|1123366
592 654552 655058 507 + 42         Uncharacterized protein YwhD locus|SA0561, protein_id|NP_373815.1, gi|15926282, geneID|1123367
593 655557 656567 1011 + 498     9: 2 11 15 16 14 17 7 10 12   Alcohol dehydrogenase (EC 1.1.1.1) gene_name|adh1, locus|SA0562, protein_id|NP_373816.1, gi|15926283, geneID|1123368
594 656843 657259 417 + 275         hypothetical fig|282458.1.peg.583 homolog locus|SA0563, protein_id|NP_373817.1, gi|15926284, geneID|1123369
595 657256 658917 1662 + -4     2: 8 3   Arginyl-tRNA synthetase (EC 6.1.1.19) gene_name|argS, locus|SA0564, protein_id|NP_373818.1, gi|15926285, geneID|1123370
596 659187 659822 636 + 269         endonuclease III domain protein locus|SA0565, protein_id|NP_373819.1, gi|15926286, geneID|1123371
597 660074 660961 888 + 251     3: 5 9 13   Vitamin B12 ABC transporter, B12-binding component BtuF locus|SA0566, protein_id|NP_373820.1, gi|15926287, geneID|1123372
598 661074 662060 987 + 112     1: 1   Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) locus|SA0567, protein_id|NP_373821.1, gi|15926288, geneID|1123373
599 662115 662834 720 + 54         L-2-haloalkanoic acid dehalogenase locus|SA0568, protein_id|NP_373822.1, gi|15926289, geneID|1123374
600 662818 663618 801 + -17         Hydrolase, alpha/beta fold family locus|SA0569, protein_id|NP_373823.1, gi|15926290, geneID|1123375
601 663754 664260 507 + 135         FIG01107935: hypothetical protein locus|SA0570, protein_id|NP_373824.1, gi|15926291, geneID|1123376
602 664422 665138 717 + 161         FIG01108193: hypothetical protein locus|SA0571, protein_id|NP_373825.1, gi|15926292, geneID|1123377

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.596 endonuclease III domain protein
MLGTDELYKLLYRHMGPQNWWPADNDIELMLGAILVQNTRWRNAEIALNQIKEHTHFNPN
HILELPIETLQSLIHSSGFYKSKTLTIKTLLTWLARHHFNYQEINERYKGGLRKELLSLK
GIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQLKKVVTLPNHFTNQDAN
EFHALLDVFGKHYFRDKDIKNYDFLEPYFKK

MD5 = 7b12c62a2aecbacdb6bb5b2b05d2c7bd


  DNA Sequence

>fig|158879.11.peg.596 endonuclease III domain protein
atgttaggaactgatgaattgtataaattgttatataggcatatgggaccgcaaaattgg
tggcctgctgataatgacattgaactgatgttaggtgcaattttagttcaaaatactaga
tggcgaaatgcagaaattgcattgaatcagattaaagaacatacgcattttaatcccaat
catatattagaactacctattgaaacgttacaatcattgatacattcaagtggcttttat
aaaagtaaaacactgacgattaaaacattattaacatggttagcacgacatcatttcaat
tatcaagagattaatgagcgatataaaggtggattaagaaaagaattattatctttgaaa
ggtattggaagtgaaacagcagatgtcttacttgtttatatattcggacgtattgaattt
attccagatagctatacaagaaaaatatatgataaattaggatatgaaaacactaaaaat
tatgatcaattaaaaaaagtagtcacattaccaaatcattttacaaatcaagatgctaat
gaatttcatgctctgttagatgtatttggtaaacattactttagagacaaagatataaag
aattatgattttttagaaccttactttaaaaagtaa


  DNA with Flanking Sequence

>fig|158879.11.peg.596 endonuclease III domain protein
gctgatttcgaacctacaattgaaagtgctgctgagcatagatcagcacatagaattact
aactatattcaagacttggctgctcatttccataaattctataatgctgaaaaagtgtta
acagatgatattgaaaaaacaaaagcacatgttgctatgattgaagcggtcagaattaca
ttgaaaaatgcattggcaatggtcggtgtaagcgcacctgaatcaatgtaagaacattta
tatacactccaacgtagagtttctcgaaagatactttgtgttggagtgtttttaattagg
tatgtgacatattggggaatgcttagtatgtgaataaggttaagagggacgcagttggat
gctactgcacaactgcataagagagcctaaatcgctaaagctcaaggggagtaaaggaat
acagttggcttgcttgcgcagcaactgcataagagcccctaattaatttattaattaggg
gctctaaaaggagggtgtaaatgttaggaactgatgaattgtataaattgttatataggc
atatgggaccgcaaaattggtggcctgctgataatgacattgaactgatgttaggtgcaa
ttttagttcaaaatactagatggcgaaatgcagaaattgcattgaatcagattaaagaac
atacgcattttaatcccaatcatatattagaactacctattgaaacgttacaatcattga
tacattcaagtggcttttataaaagtaaaacactgacgattaaaacattattaacatggt
tagcacgacatcatttcaattatcaagagattaatgagcgatataaaggtggattaagaa
aagaattattatctttgaaaggtattggaagtgaaacagcagatgtcttacttgtttata
tattcggacgtattgaatttattccagatagctatacaagaaaaatatatgataaattag
gatatgaaaacactaaaaattatgatcaattaaaaaaagtagtcacattaccaaatcatt
ttacaaatcaagatgctaatgaatttcatgctctgttagatgtatttggtaaacattact
ttagagacaaagatataaagaattatgattttttagaaccttactttaaaaagtaaacgc
tgtgaagttagatagatgagtttatatgaaatataaaaaataatttactattttctttta
gtatgtggacttatataataaatagaagcatataaagaaaaaaacagttgtttgtttgtg
cagcaactgcataaaagcctctaatcactaaaggtgaagaggaacgcagttggatgctaa
ggcacaactgcataaatccctctaatcgctaaagcgaaaagtgggattaaaaaggagatg
tgataatgtgaagaaatcgttaattgcttttattttgatttttatgcttgtcctgagtgg
ctgtggtatgaaagataatgataaacaaggtagcgatgataatggctcgtctaaatcgcc
gtaccatagaattgtttcgttaatgcctagtaatactgaaattttatatgaattaggatt
aggtaaatacatagttggtgtttcaacggttgatgattatccaaaagatgtgaaagaggg
taagaaacaatttgat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0003824       F:catalytic activity
GO:0004519       F:endonuclease activity
GO:0006284       P:base-excision repair
GO:0016798       F:hydrolase activity, acting on glycosyl bonds
cmr|NT01SA0612 Staphylococcus aureus N315     Endonuclease III domain protein
cmr|NT02SA0613 Staphylococcus aureus Mu50     DNA-(apurinic or apyrimidinic site) lyase
dbj|BAB41797.1 Staphylococcus aureus subsp. aureus N315     SA0565
dbj|BAB56770.1 Staphylococcus aureus subsp. aureus Mu50     putative endonuclease III
dbj|BAF77489.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.608 Staphylococcus aureus subsp. aureus Mu50 FIG   endonuclease III domain protein
fig|158878.14.peg.618 Staphylococcus aureus subsp. aureus Mu50 FIG   endonuclease III domain protein
fig|158879.1.peg.580 Staphylococcus aureus subsp. aureus N315 FIG   endonuclease III domain protein
fig|359786.13.peg.687 Staphylococcus aureus subsp. aureus JH9 FIG   endonuclease III domain protein
fig|359786.3.peg.2491 Staphylococcus aureus subsp. aureus JH9 FIG   endonuclease III domain protein
fig|359787.11.peg.677 Staphylococcus aureus subsp. aureus JH1 FIG   endonuclease III domain protein
fig|359787.3.peg.2367 Staphylococcus aureus subsp. aureus JH1 FIG   endonuclease III domain protein
fig|418127.4.peg.571 Staphylococcus aureus subsp. aureus Mu3 FIG   endonuclease III domain protein
fig|418127.6.peg.615 Staphylococcus aureus subsp. aureus Mu3 FIG   endonuclease III domain protein
fig|553565.3.peg.1871 Staphylococcus aureus A5937 FIG   endonuclease III domain protein
fig|553568.3.peg.2415 Staphylococcus aureus A6224 FIG   endonuclease III domain protein
fig|553571.3.peg.1295 Staphylococcus aureus A6300 FIG   endonuclease III domain protein
fig|553573.3.peg.1910 Staphylococcus aureus A8115 FIG   endonuclease III domain protein
fig|553574.3.peg.2539 Staphylococcus aureus A8117 FIG   endonuclease III domain protein
fig|553577.3.peg.2203 Staphylococcus aureus A8796 FIG   endonuclease III domain protein
fig|553580.3.peg.2132 Staphylococcus aureus A8819 FIG   endonuclease III domain protein
fig|553581.3.peg.1209 Staphylococcus aureus A9299 FIG   endonuclease III domain protein
fig|553588.3.peg.690 Staphylococcus aureus A9719 FIG   endonuclease III domain protein
fig|553592.3.peg.806 Staphylococcus aureus A9763 FIG   endonuclease III domain protein
fig|553596.3.peg.50 Staphylococcus aureus A9781 FIG   endonuclease III domain protein
fig|553601.3.peg.2159 Staphylococcus aureus A10102 FIG   endonuclease III domain protein
fig|585891.3.peg.617 Staphylococcus aureus subsp. aureus Mu50-omega FIG   endonuclease III domain protein
fig|680649.3.peg.2340 Staphylococcus aureus subsp. aureus MR1 FIG   endonuclease III domain protein
fig|681288.4.peg.566 Staphylococcus aureus subsp. aureus ED98 FIG   endonuclease III domain protein
fig|703339.3.peg.593 Staphylococcus aureus 04-02981 FIG   endonuclease III domain protein
gb|ABQ48435.1 Staphylococcus aureus subsp. aureus JH9     DNA-3-methyladenine glycosylase III
gb|ABR51504.1 Staphylococcus aureus subsp. aureus JH1     HhH-GPD family protein
gb|EEV25502.1 Staphylococcus aureus A9781     HhH-GPD family protein
gb|EEV65213.1 Staphylococcus aureus A9763     HhH-GPD family protein
gb|EEV68081.1 Staphylococcus aureus A9719     DNA repair protein
gb|EEV72765.1 Staphylococcus aureus A9299     HhH-GPD family protein
gb|EEV74642.1 Staphylococcus aureus A8115     HhH-GPD family protein
gb|EEV77809.1 Staphylococcus aureus A6300     HhH-GPD family protein
gb|EEV79594.1 Staphylococcus aureus A6224     HhH-GPD family protein
gb|EEV85516.1 Staphylococcus aureus A5937     HhH-GPD family protein
gi|13700500 Staphylococcus aureus subsp. aureus N315 NCBI   SA0565
gi|14246376 Staphylococcus aureus subsp. aureus Mu50 NCBI   putative endonuclease III
gi|147740137 Staphylococcus aureus subsp. aureus JH9 NCBI   DNA-3-methyladenine glycosylase III
gi|148267068 Staphylococcus aureus subsp. aureus JH9 NCBI   HhH-GPD family protein
gi|149945568 Staphylococcus aureus subsp. aureus JH1 NCBI   HhH-GPD family protein
gi|150393116 Staphylococcus aureus subsp. aureus JH1 NCBI   HhH-GPD family protein
gi|156721072 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978937 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0606
gi|15923598 Staphylococcus aureus subsp. aureus Mu50 NCBI   putative endonuclease III
gi|15926286 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0565
gi|255005402 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_03005
gi|257787162 Staphylococcus aureus A9781 NCBI   HhH-GPD family protein
gi|257793190 Staphylococcus aureus A9781 NCBI   HhH-GPD family protein
gi|257840755 Staphylococcus aureus A9763 NCBI   HhH-GPD family protein
gi|257843677 Staphylococcus aureus A9719 NCBI   DNA repair protein
gi|257848779 Staphylococcus aureus A9299 NCBI   HhH-GPD family protein
gi|257850696 Staphylococcus aureus A8115 NCBI   HhH-GPD family protein
gi|257854864 Staphylococcus aureus A6300 NCBI   HhH-GPD family protein
gi|257856690 Staphylococcus aureus A6224 NCBI   HhH-GPD family protein
gi|257862750 Staphylococcus aureus A5937 NCBI   HhH-GPD family protein
gi|258407675 Staphylococcus aureus A9763 NCBI   HhH-GPD family protein
gi|258420363 Staphylococcus aureus A9719 NCBI   DNA repair protein
gi|258436508 Staphylococcus aureus A9299 NCBI   HhH-GPD family protein
gi|258444096 Staphylococcus aureus A8115 NCBI   HhH-GPD family protein
gi|258446270 Staphylococcus aureus A6300 NCBI   HhH-GPD family protein
gi|258450071 Staphylococcus aureus A6224 NCBI   HhH-GPD family protein
gi|258455110 Staphylococcus aureus A5937 NCBI   HhH-GPD family protein
img|637092196 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099123 Staphylococcus aureus aureus Mu50 IMG   putative endonuclease III
img|639108230 Staphylococcus aureus aureus JH1 IMG   HhH-GPD
img|640564982 Staphylococcus aureus aureus JH9 IMG   HhH-GPD family protein
img|640778733 Staphylococcus aureus aureus JH1 IMG   HhH-GPD family protein
img|640903345 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_0646 Staphylococcus aureus subsp. aureus JH1 KEGG   HhH-GPD family protein
kegg|saj:SaurJH9_0631 Staphylococcus aureus subsp. aureus JH9 KEGG   HhH-GPD family protein
kegg|sau:SA0565   KEGG   hypothetical protein
kegg|sav:SAV0608   KEGG   putative endonuclease III
kegg|saw:SAHV_0606 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371132.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   putative endonuclease III
ref|NP_373819.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0565
ref|YP_001246011.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   HhH-GPD family protein
ref|YP_001315791.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   HhH-GPD family protein
ref|YP_001441196.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0606
ref|ZP_05144003.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_03005
ref|ZP_05642169.1 Staphylococcus aureus A9781 RefSeq   HhH-GPD family protein
ref|ZP_05680810.1 Staphylococcus aureus A9763 RefSeq   HhH-GPD family protein
ref|ZP_05683308.1 Staphylococcus aureus A9719 RefSeq   DNA repair protein
ref|ZP_05689166.1 Staphylococcus aureus A9299 RefSeq   HhH-GPD family protein
ref|ZP_05692432.1 Staphylococcus aureus A8115 RefSeq   HhH-GPD family protein
ref|ZP_05694428.1 Staphylococcus aureus A6300 RefSeq   HhH-GPD family protein
ref|ZP_05698168.1 Staphylococcus aureus A6224 RefSeq   HhH-GPD family protein
ref|ZP_05703072.1 Staphylococcus aureus A5937 RefSeq   HhH-GPD family protein
tr|A5IQG2 Staphylococcus aureus (strain JH9) TrEMBL   DNA-3-methyladenine glycosylase III
tr|A6TZ86 Staphylococcus aureus (strain JH1) TrEMBL   HhH-GPD family protein
tr|A7WZ57 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A740 Staphylococcus aureus (strain N315) TrEMBL   SA0565 protein
tr|Q99W04 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative endonuclease III


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search