The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.541: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
Translate Function Assignments



Context on contig NC_002745 from base 596093 to 608076 (11984 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
536 596093 597733 1641 +           Ribulokinase (EC 2.7.1.16) gene_name|araB, locus|SA0510, protein_id|NP_373763.1, gi|15926230, geneID|1123315
537 597947 598912 966 + 213     3: 13 14 15   L-threonine 3-dehydrogenase (EC 1.1.1.103) locus|SA0511, protein_id|NP_373764.1, gi|15926231, geneID|1123316
538 599248 600324 1077 + 335     12: 19 12 17 7 8 11 4 6 16 9 18 5   Branched-chain amino acid aminotransferase (EC 2.6.1.42) gene_name|ilvE, locus|SA0512, protein_id|NP_373765.1, gi|15926232, geneID|1123317
539 600574 601257 684 + 249         Hydrolase, haloacid dehalogenase-like family locus|SA0513, protein_id|NP_373766.1, gi|15926233, geneID|1123318
540 602035 601373 663 - 115 13 2: 2 1   Deoxyadenosine kinase (EC 2.7.1.76) @ Deoxycytidine kinase (EC 2.7.1.74) # yaaF locus|SA0514, protein_id|NP_373767.1, gi|15926234, geneID|1123319
541 602645 602028 618 - -8   2: 2 1   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG locus|SA0515, protein_id|NP_373768.1, gi|15926235, geneID|1123320
542 602712 603182 471 + 66     2: 20 10   tRNA adenosine(34) deaminase (EC 3.5.4.33) locus|SA0516, protein_id|NP_373769.1, gi|15926236, geneID|1123321
543 603329 604198 870 + 146         Hydrolase, HAD superfamily locus|SA0517, protein_id|NP_373770.1, gi|15926237, geneID|1123322
544 604220 604786 567 + 21       dlit(15870453) Predicted flavoprotein locus|SA0518, protein_id|NP_373771.1, gi|15926238, geneID|1123323
545 605215 608076 2862 + 428     1: 3   Adhesin of unknown specificity SdrC gene_name|sdrC, locus|SA0519, protein_id|NP_373772.1, gi|15926239, geneID|1123324

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Purine_conversions OlgaV Deoxyadenosine kinase (EC 2.7.1.76)
Purine_conversions OlgaV Deoxyguanosine kinase (EC 2.7.1.113)
Purine_conversions_exploration ZALLOT_Remi_user Deoxyadenosine kinase (EC 2.7.1.76)
Purine_conversions_exploration ZALLOT_Remi_user Deoxyguanosine kinase (EC 2.7.1.113)


  Protein Sequence

>fig|158879.11.peg.541 Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDFYEDISKWSFQTEMFF
LCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSPVEFQKFSKIYDILTEDMIMPNMI
IFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYESLQSNGSNVVLIDTTSID
FLKNEQDYEDILHIILPMIGDITNE

MD5 = 8f7a35e327a3eb3d8df2ff6eac90a0be


  DNA Sequence

>fig|158879.11.peg.541 Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
atgaacaaaccttttatagcaattgaaggtcctattggcgtaggtaaatcttcacttgca
cacaaattaagtcaaactttagatttttatgaagaaaaagaaatcatcacagaaaatcca
tttttatcagacttttatgaagatatctctaaatggagttttcaaactgaaatgttcttt
ttatgcaatagatataagcaatttcaagatgtaacacaactaaatcaaggtgtagttagt
gattatcatatacataaaaataagatatttgctaaaaatactttgagtcctgttgaattt
cagaaattcagtaaaatttatgatattttaactgaagatatgattatgccgaatatgatt
atctttttagatgcagaccttgatgtgttaaaatctagaattgctaaacgtaaccgtagt
tttgagcatcaaatagaagatgaatatctgttaaagttaaaaaaagattatcgtgagtat
tatgagtccttacaaagtaatggttcaaatgtagttttaatcgatacaacttctattgat
tttcttaaaaatgaacaagattacgaagatatattacatattatattacctatgatagga
gatattaccaatgaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.541 Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
aaaaatgttgttaataatgtgctacatgcttctttaagtacacctttatcaacaattgca
cgatgattaaaattagattgttgcaataaattcattaaactgccactacaaccaccttta
ggatcatctgcgccatagacgactcttggaatgcgactcattacaattgttcctgcgcac
atgacacatggttctaaggttacatataatgtgcaaccttctaaacgccaactacctaac
actttggctgcacgttcaattgcaatatgttcagcatgcgccgttggttgttgtagtgtt
tctcttaaattatgtgctctagcgataacttcatcatctttagtgatgatagcacctata
ggtacttcgcctagttgagctgcttttttagcttcttcaatcgctaatgtcataaaatat
atatcatttgtcatttatgtccagatacctcacttatggtacaatactcaatgtctattt
taacatttggagatgtgaatatgaacaaaccttttatagcaattgaaggtcctattggcg
taggtaaatcttcacttgcacacaaattaagtcaaactttagatttttatgaagaaaaag
aaatcatcacagaaaatccatttttatcagacttttatgaagatatctctaaatggagtt
ttcaaactgaaatgttctttttatgcaatagatataagcaatttcaagatgtaacacaac
taaatcaaggtgtagttagtgattatcatatacataaaaataagatatttgctaaaaata
ctttgagtcctgttgaatttcagaaattcagtaaaatttatgatattttaactgaagata
tgattatgccgaatatgattatctttttagatgcagaccttgatgtgttaaaatctagaa
ttgctaaacgtaaccgtagttttgagcatcaaatagaagatgaatatctgttaaagttaa
aaaaagattatcgtgagtattatgagtccttacaaagtaatggttcaaatgtagttttaa
tcgatacaacttctattgattttcttaaaaatgaacaagattacgaagatatattacata
ttatattacctatgataggagatattaccaatgaataattacggtattccacaaaatgcc
attataaccattgcaggtacagttggtgttggaaaatcaacactaacgcaagcacttgca
gataaattaaactttaaaacgtcttttgaaaatgtcgaacataatccatatttagataaa
ttttatagcgattttgaacgatggagtttccatttgcaaatttacttcttagctgaacgt
tttaaagaacaaaagcgtatgtttgaatatggtggtggctttgtccaagatcgatcaatt
tatgaagatgttgatatttttgcaaaaatgcatgaagaagaaggcacaatgagtaaagaa
gatttcaaaacatattcagacttatttaatgccatggtcatgacaccttattttcctaaa
ccagatgtaatgatttatttagaatgtaactatgatgaggtcattgatcgtattattgaa
cgtggtcgcgaaatggaaattaatacagaccctgaatactggaaaaagctatttaaac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0006139       P:nucleobase, nucleoside, nucleotide and nucl...
GO:0016301       F:kinase activity
GO:0016773       F:phosphotransferase activity, alcohol group ...
cmr|NT01SA0560 Staphylococcus aureus N315     deoxynucleoside kinase family protein
cmr|NT02SA0564 Staphylococcus aureus Mu50     deoxypurine kinase
dbj|BAB41746.1 Staphylococcus aureus subsp. aureus N315     SA0515
dbj|BAB56719.1 Staphylococcus aureus subsp. aureus Mu50     similar to deoxypurine kinase
dbj|BAF77438.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.557 Staphylococcus aureus subsp. aureus Mu50 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|158878.14.peg.563 Staphylococcus aureus subsp. aureus Mu50 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|158879.1.peg.529 Staphylococcus aureus subsp. aureus N315 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|359786.13.peg.632 Staphylococcus aureus subsp. aureus JH9 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|359787.11.peg.622 Staphylococcus aureus subsp. aureus JH1 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|418127.6.peg.560 Staphylococcus aureus subsp. aureus Mu3 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|505321.3.peg.1172 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553565.3.peg.498 Staphylococcus aureus A5937 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553568.3.peg.731 Staphylococcus aureus A6224 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553571.3.peg.1350 Staphylococcus aureus A6300 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553573.3.peg.1869 Staphylococcus aureus A8115 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553574.3.peg.2302 Staphylococcus aureus A8117 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553577.3.peg.2293 Staphylococcus aureus A8796 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553580.3.peg.2077 Staphylococcus aureus A8819 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553581.3.peg.2343 Staphylococcus aureus A9299 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553588.3.peg.718 Staphylococcus aureus A9719 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553592.3.peg.1272 Staphylococcus aureus A9763 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553596.3.peg.2270 Staphylococcus aureus A9781 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|553601.3.peg.2286 Staphylococcus aureus A10102 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|585891.3.peg.562 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|680649.3.peg.2056 Staphylococcus aureus subsp. aureus MR1 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|681288.4.peg.510 Staphylococcus aureus subsp. aureus ED98 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
fig|703339.3.peg.538 Staphylococcus aureus 04-02981 FIG   Deoxyguanosine kinase (EC 2.7.1.113) # yaaG
gi|13700449 Staphylococcus aureus subsp. aureus N315 NCBI   SA0515
gi|14246325 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to deoxypurine kinase
gi|156721021 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978886 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0555
gi|15923547 Staphylococcus aureus subsp. aureus Mu50 NCBI   deoxypurine kinase
gi|15926235 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0515
gi|253315667 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   deoxynucleoside kinase
gi|255005351 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   deoxynucleoside kinase
img|637092145 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099072 Staphylococcus aureus aureus Mu50 IMG   similar to deoxypurine kinase
img|640903294 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sau:SA0515   KEGG   hypothetical protein
kegg|sav:SAV0557   KEGG   deoxypurine kinase
kegg|saw:SAHV_0555 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371081.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   deoxypurine kinase
ref|NP_373768.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0515
ref|YP_001441145.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0555
ref|ZP_04838880.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   deoxynucleoside kinase
ref|ZP_05143952.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   deoxynucleoside kinase
tr|A7WYY9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A785 Staphylococcus aureus (strain N315) TrEMBL   SA0515 protein
tr|Q99W52 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to deoxypurine kinase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
13 fig|158879.11.peg.540 Deoxyadenosine kinase (EC 2.7.1.76) @ Deoxycytidine kinase (EC 2.7.1.74) # yaaF


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search