The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|158879.11.peg.519: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Protein translocase subunit SecE
Translate Function Assignments


Context on contig NC_002745 from base 570529 to 583171 (12643 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
512 570529 571170 642 +   9 5: 11 14 18 17 8   Serine acetyltransferase (EC 2.3.1.30) gene_name|cysE, locus|SA0487, protein_id|NP_373739.1, gi|15926206, geneID|1123291
513 571154 572554 1401 + -17 6 2: 12 15   Cysteinyl-tRNA synthetase (EC 6.1.1.16) gene_name|cysS, locus|SA0488, protein_id|NP_373740.1, gi|15926207, geneID|1123292
514 572547 572951 405 + -8 6     Mini-ribonuclease III ## 23S rRNA maturase locus|SA0489, protein_id|NP_373741.1, gi|15926208, geneID|1123293
515 572959 573705 747 + 7 8     23S rRNA (guanosine(2251)-2'-O)-methyltransferase (EC 2.1.1.185) ## RlmB locus|SA0490, protein_id|NP_373742.1, gi|15926209, geneID|1123294
516 573705 574229 525 + -1 5     Uncharacterized protein YacP, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins locus|SA0491, protein_id|NP_373743.1, gi|15926210, geneID|1123295
517 574310 574879 570 + 80     2: 16 10   RNA polymerase sporulation specific sigma factor SigH locus|SA0492, protein_id|NP_373744.1, gi|15926211, geneID|1123296
518 574994 575137 144 + 114 6 3: 3 2 7   LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent  
519 575193 575375 183 + 55   1: 1   Protein translocase subunit SecE gene_name|secE, locus|SA0493, protein_id|NP_373745.1, gi|15926212, geneID|1123297
520 575388 575936 549 + 12 4 2: 9 1   Transcription termination/antitermination protein NusG gene_name|nusG, locus|SA0494, protein_id|NP_373746.1, gi|15926213, geneID|1123298
521 576117 576539 423 + 180     5: 4 3 2 5 1   LSU ribosomal protein L11p (L12e) gene_name|rplK, locus|SA0495, protein_id|NP_373748.1, gi|15926215, geneID|1123300
522 576747 577439 693 + 207     6: 4 3 2 6 5 1   LSU ribosomal protein L1p (L10Ae) gene_name|rplA, locus|SA0496, protein_id|NP_373749.1, gi|15926216, geneID|1123301
523 577711 578211 501 + 271     4: 4 3 2 1   LSU ribosomal protein L10p (P0) gene_name|rplJ, locus|SA0497, protein_id|NP_373750.1, gi|15926217, geneID|1123302
524 578254 578622 369 + 42     5: 4 3 2 5 1   LSU ribosomal protein L7p/L12p (P1/P2) gene_name|rplL, locus|SA0498, protein_id|NP_373751.1, gi|15926218, geneID|1123303
525 578797 579405 609 + 174         16S rRNA (guanine(1207)-N(2))-methyltransferase (EC 2.1.1.172) ## RsmC locus|SA0499, protein_id|NP_373752.1, gi|15926219, geneID|1123304
526 579620 583171 3552 + 214     2: 13 6   DNA-directed RNA polymerase beta subunit (EC 2.7.7.6) gene_name|rpoB, locus|SA0500, protein_id|NP_373753.1, gi|15926220, geneID|1123305

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
LSU_ribosomal_proteins_cluster Preprotein translocase subunit SecE (TC 3.A.5.1.1)


  Protein Sequence

>fig|158879.11.peg.519 Protein translocase subunit SecE
MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG

MD5 = 0c80ff62183dff23875b0cf11d808ea7


  DNA Sequence

>fig|158879.11.peg.519 Protein translocase subunit SecE
atggctaaaaaagaaagtttctttaaaggcgttaagtctgaaatggaaaaaacaagttgg
ccgacgaaagaagagctatttaaatatactgtaattgtagtttctactgttatattcttc
ttagtctttttctatgccttagatttaggaattacagcattgaaaaatttattatttggt
tag


  DNA with Flanking Sequence

>fig|158879.11.peg.519 Protein translocase subunit SecE
agcaattaaagagttgatttgtcagtttaagtatttgagtgcatttgaaaaagatgtcat
gtatttaatgtgtgaacaatataagccgagagaaattgctcaattgatgcatgtaaaaga
gaaagtgatttataatgccatacaacgatgtaaaaataaaataaaacgttatttcaaaat
gatttgaaaagcgccttaggacgtgaattgaattataacgtgttacttactgatggtttg
acatttgttataaattttatgtatagtatactggtattataatgaataaaggtgaattat
tgtgagaaaaatacctttaaattgtgaagcttgtggcaatagaaattataatgttcctaa
gcaagaaggctcggcaacaagattaaccttaaagaaatattgtccaaaatgtaacgcgca
cacaattcataaagaatcgaaataaatacattcgaaataatactttgataatatgttcaa
aggatttggaggttgagcagatggctaaaaaagaaagtttctttaaaggcgttaagtctg
aaatggaaaaaacaagttggccgacgaaagaagagctatttaaatatactgtaattgtag
tttctactgttatattcttcttagtctttttctatgccttagatttaggaattacagcat
tgaaaaatttattatttggttagaggagtgaagacatgtctgaagaagttggcgcaaagc
gttggtatgcagtgcatacatattctggatatgaaaataaagttaaaaagaatttagaaa
aaagagtagaatctatgaatatgactgaacaaatctttagagtagtcataccggaagaag
aagaaactcaagtaaaagatggcaaagctaaaacgactgttaaaaaaacattccctggat
atgttttagtggaattaatcatgacagatgaatcatggtatgtggtaagaaatacaccag
gcgttactggttttgtaggttctgcaggtgcagggtctaagccaaatccattgttaccag
aagaagttcgcttcatcttaaaacaaatgggtcttaaagaaaagactatcgatgttgaac
tcgaagttggcgagcaagttcgtattaaatcaggtccatttgcgaatcaagttggtgaag
ttcaagaaattgaaacagataagtttaagctaacagtattagt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
GO:0006605       P:protein targeting
GO:0009306       P:protein secretion
GO:0015450       F:P-P-bond-hydrolysis-driven protein transmem...
GO:0016021       C:integral to membrane
GO:0065002       P:intracellular protein transmembrane transport
cmr|NT05SA0467 Staphylococcus aureus NCTC 8325     preprotein translocase, SecE subunit
cmr|NT11SA0499 Staphylococcus aureus RF122     preprotein translocase, SecE subunit
dbj|BAB41723.1 Staphylococcus aureus subsp. aureus N315     preprotein translocase subunit
dbj|BAB56696.1 Staphylococcus aureus subsp. aureus Mu50     preprotein translocase subunit
dbj|BAB94355.1 Staphylococcus aureus subsp. aureus MW2     preprotein translocase subunit
dbj|BAF77415.1 Staphylococcus aureus subsp. aureus Mu3     preprotein translocase subunit
emb|CAG39561.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   preprotein translocase SecE subunit
emb|CAG42268.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   preprotein translocase SecE subunit
emb|CAI80174.1 Staphylococcus aureus RF122 EMBL   preprotein translocase subunit
fig|158878.1.peg.534 Staphylococcus aureus subsp. aureus Mu50 FIG   Protein translocase subunit SecE
fig|158878.14.peg.541 Staphylococcus aureus subsp. aureus Mu50 FIG   Protein translocase subunit SecE
fig|158879.1.peg.506 Staphylococcus aureus subsp. aureus N315 FIG   Protein translocase subunit SecE
fig|196620.1.peg.490 Staphylococcus aureus subsp. aureus MW2 FIG   Protein translocase subunit SecE
fig|196620.5.peg.519 Staphylococcus aureus subsp. aureus MW2 FIG   Protein translocase subunit SecE
fig|273036.3.peg.33 Staphylococcus aureus RF122 FIG   Protein translocase subunit SecE
fig|273036.6.peg.527 Staphylococcus aureus RF122 FIG   Protein translocase subunit SecE
fig|282458.1.peg.512 Staphylococcus aureus subsp. aureus MRSA252 FIG   Protein translocase subunit SecE
fig|282458.4.peg.548 Staphylococcus aureus subsp. aureus MRSA252 FIG   Protein translocase subunit SecE
fig|282459.1.peg.488 Staphylococcus aureus subsp. aureus MSSA476 FIG   Protein translocase subunit SecE
fig|282459.5.peg.515 Staphylococcus aureus subsp. aureus MSSA476 FIG   Protein translocase subunit SecE
fig|359786.13.peg.610 Staphylococcus aureus subsp. aureus JH9 FIG   Protein translocase subunit SecE
fig|359786.3.peg.719 Staphylococcus aureus subsp. aureus JH9 FIG   Protein translocase subunit SecE
fig|359787.11.peg.600 Staphylococcus aureus subsp. aureus JH1 FIG   Protein translocase subunit SecE
fig|359787.3.peg.407 Staphylococcus aureus subsp. aureus JH1 FIG   Protein translocase subunit SecE
fig|418127.4.peg.501 Staphylococcus aureus subsp. aureus Mu3 FIG   Protein translocase subunit SecE
fig|418127.6.peg.538 Staphylococcus aureus subsp. aureus Mu3 FIG   Protein translocase subunit SecE
fig|450394.6.peg.440 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Protein translocase subunit SecE
fig|505321.3.peg.1150 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Protein translocase subunit SecE
fig|548470.3.peg.1565 Staphylococcus aureus subsp. aureus MN8 FIG   Protein translocase subunit SecE
fig|548473.3.peg.1395 Staphylococcus aureus subsp. aureus TCH60 FIG   Protein translocase subunit SecE
fig|548474.3.peg.2101 Staphylococcus aureus subsp. aureus TCH130 FIG   Protein translocase subunit SecE
fig|548475.3.peg.19 Staphylococcus aureus subsp. aureus TCH70 FIG   Protein translocase subunit SecE
fig|553565.3.peg.520 Staphylococcus aureus A5937 FIG   Protein translocase subunit SecE
fig|553568.3.peg.753 Staphylococcus aureus A6224 FIG   Protein translocase subunit SecE
fig|553571.3.peg.1372 Staphylococcus aureus A6300 FIG   Protein translocase subunit SecE
fig|553573.3.peg.1891 Staphylococcus aureus A8115 FIG   Protein translocase subunit SecE
fig|553574.3.peg.2280 Staphylococcus aureus A8117 FIG   Protein translocase subunit SecE
fig|553577.3.peg.2315 Staphylococcus aureus A8796 FIG   Protein translocase subunit SecE
fig|553580.3.peg.2055 Staphylococcus aureus A8819 FIG   Protein translocase subunit SecE
fig|553581.3.peg.2365 Staphylococcus aureus A9299 FIG   Protein translocase subunit SecE
fig|553583.3.peg.130 Staphylococcus aureus A9635 FIG   Protein translocase subunit SecE
fig|553588.3.peg.740 Staphylococcus aureus A9719 FIG   Protein translocase subunit SecE
fig|553592.3.peg.1250 Staphylococcus aureus A9763 FIG   Protein translocase subunit SecE
fig|553596.3.peg.2292 Staphylococcus aureus A9781 FIG   Protein translocase subunit SecE
fig|553601.3.peg.2264 Staphylococcus aureus A10102 FIG   Protein translocase subunit SecE
fig|585143.3.peg.1045 Staphylococcus aureus subsp. aureus 55/2053 FIG   Protein translocase subunit SecE
fig|585144.3.peg.1056 Staphylococcus aureus subsp. aureus 58-424 FIG   Protein translocase subunit SecE
fig|585145.3.peg.1038 Staphylococcus aureus subsp. aureus 65-1322 FIG   Protein translocase subunit SecE
fig|585146.3.peg.1043 Staphylococcus aureus subsp. aureus 68-397 FIG   Protein translocase subunit SecE
fig|585147.3.peg.61 Staphylococcus aureus subsp. aureus A017934/97 FIG   Protein translocase subunit SecE
fig|585148.3.peg.61 Staphylococcus aureus subsp. aureus Btn1260 FIG   Protein translocase subunit SecE
fig|585149.6.peg.666 Staphylococcus aureus subsp. aureus C101 FIG   Protein translocase subunit SecE
fig|585150.3.peg.1086 Staphylococcus aureus subsp. aureus C160 FIG   Protein translocase subunit SecE
fig|585151.3.peg.155 Staphylococcus aureus subsp. aureus C427 FIG   Protein translocase subunit SecE
fig|585152.3.peg.452 Staphylococcus aureus subsp. aureus D139 FIG   Protein translocase subunit SecE
fig|585153.3.peg.1096 Staphylococcus aureus subsp. aureus E1410 FIG   Protein translocase subunit SecE
fig|585154.3.peg.495 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Protein translocase subunit SecE
fig|585155.3.peg.1078 Staphylococcus aureus subsp. aureus H19 FIG   Protein translocase subunit SecE
fig|585156.3.peg.62 Staphylococcus aureus subsp. aureus M1015 FIG   Protein translocase subunit SecE
fig|585157.3.peg.184 Staphylococcus aureus subsp. aureus M809 FIG   Protein translocase subunit SecE
fig|585158.3.peg.1036 Staphylococcus aureus subsp. aureus M876 FIG   Protein translocase subunit SecE
fig|585159.3.peg.650 Staphylococcus aureus subsp. aureus M899 FIG   Protein translocase subunit SecE
fig|585160.3.peg.59 Staphylococcus aureus subsp. aureus WBG10049 FIG   Protein translocase subunit SecE
fig|585161.3.peg.398 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Protein translocase subunit SecE
fig|585891.3.peg.540 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Protein translocase subunit SecE
fig|680649.3.peg.1130 Staphylococcus aureus subsp. aureus MR1 FIG   Protein translocase subunit SecE
fig|681288.4.peg.488 Staphylococcus aureus subsp. aureus ED98 FIG   Protein translocase subunit SecE
fig|703339.3.peg.516 Staphylococcus aureus 04-02981 FIG   Protein translocase subunit SecE
fig|762962.3.peg.159 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Protein translocase subunit SecE
fig|93061.5.peg.463 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Protein translocase subunit SecE
gb|AAB54017.1 Staphylococcus aureus     SecE
gb|ABQ48362.1 Staphylococcus aureus subsp. aureus JH9     preprotein translocase, SecE subunit
gb|ABR51430.1 Staphylococcus aureus subsp. aureus JH1     preprotein translocase, SecE subunit
gb|EEI95946.1 Staphylococcus aureus subsp. aureus MN8     Sec family type I general secretory pathway preprotein translocase subunit SecE
gb|EEJ62035.1 Staphylococcus aureus subsp. aureus TCH60     Sec family type I general secretory pathway preprotein translocase subunit SecE
gb|EES55643.1 Staphylococcus aureus subsp. aureus TCH70     Sec family type I preprotein translocase, subunit SecE
gb|EES93834.1 Staphylococcus aureus subsp. aureus USA300_TCH959     Sec family type I general secretory pathway preprotein translocase subunit SecE
gb|EES98201.1 Staphylococcus aureus subsp. aureus TCH130     Sec family type I general secretory pathway preprotein translocase subunit SecE
gb|EEV04342.1 Staphylococcus aureus subsp. aureus 55/2053     preprotein translocase subunit secE
gb|EEV06983.1 Staphylococcus aureus subsp. aureus 65-1322     preprotein translocase subunit secE
gb|EEV09751.1 Staphylococcus aureus subsp. aureus 68-397     translocase subunit SecE
gb|EEV12205.1 Staphylococcus aureus subsp. aureus E1410     translocase subunit secE
gb|EEV14869.1 Staphylococcus aureus subsp. aureus M876     preprotein translocase, SecE subunit
gb|EEV71672.1 Staphylococcus aureus A9299     translocase subunit secE
gb|EEV74691.1 Staphylococcus aureus A8115     translocase subunit secE
gb|EEV77883.1 Staphylococcus aureus A6300     preprotein translocase subunit secE
gb|EEV81193.1 Staphylococcus aureus A6224     preprotein translocase, SecE subunit
gb|EEV86803.1 Staphylococcus aureus A5937     preprotein translocase, SecE subunit
gi|13700425 Staphylococcus aureus subsp. aureus N315 NCBI   preprotein translocase subunit
gi|14246302 Staphylococcus aureus subsp. aureus Mu50 NCBI   preprotein translocase subunit
gi|147740064 Staphylococcus aureus subsp. aureus JH9 NCBI   preprotein translocase, SecE subunit
gi|148266995 Staphylococcus aureus subsp. aureus JH9 NCBI   preprotein translocase subunit SecE
gi|149945494 Staphylococcus aureus subsp. aureus JH1 NCBI   preprotein translocase, SecE subunit
gi|150393042 Staphylococcus aureus subsp. aureus JH1 NCBI   preprotein translocase subunit SecE
gi|156720998 Staphylococcus aureus subsp. aureus Mu3 NCBI   preprotein translocase subunit
gi|156978863 Staphylococcus aureus subsp. aureus Mu3 NCBI   preprotein translocase subunit SecE
gi|15923524 Staphylococcus aureus subsp. aureus Mu50 NCBI   preprotein translocase subunit SecE
gi|15926212 Staphylococcus aureus subsp. aureus N315 NCBI   preprotein translocase subunit SecE
gi|161353533 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   preprotein translocase subunit SecE
gi|2078376 Staphylococcus aureus NCBI   SecE
gi|21203655 Staphylococcus aureus subsp. aureus MW2 NCBI   preprotein translocase subunit
gi|21282219 Staphylococcus aureus subsp. aureus MW2 NCBI   preprotein translocase subunit SecE
gi|227246187 Staphylococcus aureus subsp. aureus MN8 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|227557417 Staphylococcus aureus subsp. aureus MN8 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|227852237 Staphylococcus aureus subsp. aureus TCH60 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|227899474 Staphylococcus aureus subsp. aureus TCH60 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|251802986 Staphylococcus aureus subsp. aureus TCH70 NCBI   Sec family type I preprotein translocase, subunit SecE
gi|251813484 Staphylococcus aureus subsp. aureus TCH70 NCBI   Sec family type I preprotein translocase, subunit SecE
gi|253315645 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   preprotein translocase subunit SecE
gi|253725105 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|253729472 Staphylococcus aureus subsp. aureus TCH130 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|253731140 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|253732543 Staphylococcus aureus subsp. aureus TCH130 NCBI   Sec family type I general secretory pathway preprotein translocase subunit SecE
gi|255005329 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   preprotein translocase subunit SecE
gi|257272219 Staphylococcus aureus subsp. aureus 55/2053 NCBI   preprotein translocase subunit secE
gi|257275510 Staphylococcus aureus subsp. aureus 65-1322 NCBI   preprotein translocase subunit secE
gi|257279150 Staphylococcus aureus subsp. aureus 68-397 NCBI   translocase subunit SecE
gi|257282070 Staphylococcus aureus subsp. aureus E1410 NCBI   translocase subunit secE
gi|257284750 Staphylococcus aureus subsp. aureus M876 NCBI   preprotein translocase, SecE subunit
gi|257424649 Staphylococcus aureus subsp. aureus 55/2053 NCBI   preprotein translocase subunit secE
gi|257427317 Staphylococcus aureus subsp. aureus 65-1322 NCBI   preprotein translocase subunit secE
gi|257429953 Staphylococcus aureus subsp. aureus 68-397 NCBI   translocase subunit SecE
gi|257432655 Staphylococcus aureus subsp. aureus E1410 NCBI   translocase subunit secE
gi|257435559 Staphylococcus aureus subsp. aureus M876 NCBI   preprotein translocase, SecE subunit
gi|257847673 Staphylococcus aureus A9299 NCBI   translocase subunit secE
gi|257850746 Staphylococcus aureus A8115 NCBI   translocase subunit secE
gi|257854938 Staphylococcus aureus A6300 NCBI   preprotein translocase subunit secE
gi|257858306 Staphylococcus aureus A6224 NCBI   preprotein translocase, SecE subunit
gi|257864049 Staphylococcus aureus A5937 NCBI   preprotein translocase, SecE subunit
gi|258439336 Staphylococcus aureus A9299 NCBI   translocase subunit secE
gi|258444076 Staphylococcus aureus A8115 NCBI   translocase subunit secE
gi|258446344 Staphylococcus aureus A6300 NCBI   preprotein translocase subunit secE
gi|258448437 Staphylococcus aureus A6224 NCBI   preprotein translocase, SecE subunit
gi|258453793 Staphylococcus aureus A5937 NCBI   preprotein translocase, SecE subunit
gi|49240894 Staphylococcus aureus subsp. aureus MRSA252 NCBI   preprotein translocase SecE subunit
gi|49243843 Staphylococcus aureus subsp. aureus MSSA476 NCBI   preprotein translocase SecE subunit
gi|49482765 Staphylococcus aureus subsp. aureus MRSA252 NCBI   preprotein translocase subunit SecE
gi|49485400 Staphylococcus aureus subsp. aureus MSSA476 NCBI   preprotein translocase subunit SecE
gi|60390819 organism not parsed/found in ncbi nr NCBI   RecName: Full=Preprotein translocase subunit secE
gi|60390826 organism not parsed/found in ncbi nr NCBI   RecName: Full=Preprotein translocase subunit secE
gi|60409398 organism not parsed/found in ncbi nr NCBI   RecName: Full=Preprotein translocase subunit secE
gi|60409401 organism not parsed/found in ncbi nr NCBI   RecName: Full=Preprotein translocase subunit secE
gi|60409405 organism not parsed/found in ncbi nr NCBI   RecName: Full=Preprotein translocase subunit secE
gi|60409408 organism not parsed/found in ncbi nr NCBI   RecName: Full=Preprotein translocase subunit secE
gi|82655774 Staphylococcus aureus RF122 NCBI   preprotein translocase subunit
gi|82750243 Staphylococcus aureus RF122 NCBI   preprotein translocase subunit SecE
img|637092122 Staphylococcus aureus aureus N315 IMG   preprotein translocase subunit
img|637099049 Staphylococcus aureus aureus Mu50 IMG   preprotein translocase subunit
img|637154010 Staphylococcus aureus aureus MRSA252 IMG   preprotein translocase SecE subunit
img|637156721 Staphylococcus aureus aureus MSSA476 IMG   preprotein translocase SecE subunit
img|637298250 Staphylococcus aureus aureus MW2 IMG   preprotein translocase subunit
img|637815451 Staphylococcus aureus RF122 IMG   preprotein translocase subunit
img|639109670 Staphylococcus aureus aureus JH1 IMG   SecE subunit of protein translocation complex
img|640564909 Staphylococcus aureus aureus JH9 IMG   preprotein translocase, SecE subunit
img|640778659 Staphylococcus aureus aureus JH1 IMG   preprotein translocase, SecE subunit
img|640903271 Staphylococcus aureus aureus Mu3 IMG   preprotein translocase subunit
kegg|sab:SAB0486 Staphylococcus aureus RF122 KEGG   preprotein translocase subunit SecE
kegg|sah:SaurJH1_0572 Staphylococcus aureus subsp. aureus JH1 KEGG   preprotein translocase subunit SecE
kegg|saj:SaurJH9_0558 Staphylococcus aureus subsp. aureus JH9 KEGG   preprotein translocase subunit SecE
kegg|sam:MW0490 Staphylococcus aureus subsp. aureus MW2 KEGG   preprotein translocase subunit SecE
kegg|sao:SAOUHSC_00516 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   preprotein translocase subunit SecE
kegg|sar:SAR0539   KEGG   preprotein translocase subunit SecE
kegg|sas:SAS0493   KEGG   preprotein translocase subunit SecE
kegg|sau:SA0493   KEGG   preprotein translocase subunit SecE
kegg|sav:SAV0534   KEGG   preprotein translocase subunit SecE
kegg|saw:SAHV_0532 Staphylococcus aureus subsp. aureus Mu3 KEGG   preprotein translocase subunit SecE
ref|NP_371058.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   preprotein translocase subunit SecE
ref|NP_373745.1 Staphylococcus aureus subsp. aureus N315 RefSeq   preprotein translocase subunit SecE
ref|NP_645307.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   preprotein translocase subunit SecE
ref|YP_001245938.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   preprotein translocase subunit SecE
ref|YP_001315717.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   preprotein translocase subunit SecE
ref|YP_001441122.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   preprotein translocase subunit SecE
ref|YP_039989.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   preprotein translocase subunit SecE
ref|YP_042621.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   preprotein translocase subunit SecE
ref|YP_415984.1 Staphylococcus aureus RF122 RefSeq   preprotein translocase subunit SecE
ref|YP_499089.2 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   preprotein translocase subunit SecE
ref|ZP_03987464.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   Sec family type I general secretory pathway preprotein translocase subunit SecE
ref|ZP_04017279.1 Staphylococcus aureus subsp. aureus TCH60 RefSeq   Sec family type I general secretory pathway preprotein translocase subunit SecE
ref|ZP_04827957.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   Sec family type I preprotein translocase, subunit SecE
ref|ZP_04838858.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   preprotein translocase subunit SecE
ref|ZP_04865305.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   Sec family type I general secretory pathway preprotein translocase subunit SecE
ref|ZP_04866708.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   Sec family type I general secretory pathway preprotein translocase subunit SecE
ref|ZP_05143930.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   preprotein translocase subunit SecE
ref|ZP_05601076.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   preprotein translocase subunit secE
ref|ZP_05603716.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   preprotein translocase subunit secE
ref|ZP_05606337.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   translocase subunit SecE
ref|ZP_05609015.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   translocase subunit secE
ref|ZP_05611607.1 Staphylococcus aureus subsp. aureus M876 RefSeq   preprotein translocase, SecE subunit
ref|ZP_05690268.1 Staphylococcus aureus A9299 RefSeq   translocase subunit secE
ref|ZP_05692413.1 Staphylococcus aureus A8115 RefSeq   translocase subunit secE
ref|ZP_05694502.1 Staphylococcus aureus A6300 RefSeq   preprotein translocase subunit secE
ref|ZP_05696552.1 Staphylococcus aureus A6224 RefSeq   preprotein translocase, SecE subunit
ref|ZP_05701767.1 Staphylococcus aureus A5937 RefSeq   preprotein translocase, SecE subunit
sp|P0A0I1 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Preprotein translocase subunit secE
sp|P0A0I2 Staphylococcus aureus (strain N315) SwissProt   Preprotein translocase subunit secE
sp|P0A0I3 Staphylococcus aureus (strain MW2) SwissProt   Preprotein translocase subunit secE
sp|P0A0I4 Staphylococcus aureus (strain NCTC 8325) SwissProt   Preprotein translocase subunit secE
sp|Q6GBV2 Staphylococcus aureus (strain MSSA476) SwissProt   Preprotein translocase subunit secE
sp|Q6GJD3 Staphylococcus aureus (strain MRSA252) SwissProt   Preprotein translocase subunit secE
sp|SECE_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Preprotein translocase subunit secE
sp|SECE_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Preprotein translocase subunit secE
sp|SECE_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Preprotein translocase subunit secE
sp|SECE_STAAR organism not parsed/found in ncbi nr SwissProt   RecName: Full=Preprotein translocase subunit secE
sp|SECE_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Preprotein translocase subunit secE
sp|SECE_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Preprotein translocase subunit secE
tr|A5IQ89 Staphylococcus aureus (strain JH9) TrEMBL   Preprotein translocase, SecE subunit
tr|A6TZ12 Staphylococcus aureus (strain JH1) TrEMBL   Preprotein translocase, SecE subunit
tr|A7WYV5 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Preprotein translocase subunit
tr|C2GA96 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   Sec family type I general secretory pathway preprotein translocase subunit SecE
tr|C2K5S4 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Sec family type I general secretory pathway preprotein translocase subunit SecE
tr|C5N2W0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Sec family type I general secretory pathway preprotein translocase subunit SecE
tr|C5PXT9 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Sec family type I general secretory pathway preprotein translocase subunit SecE
tr|C5QGQ5 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Sec family type I preprotein translocase, subunit SecE
tr|Q2YSC6 Staphylococcus aureus (strain bovine RF122 / ET3-1) TrEMBL   Preprotein translocase subunit


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function
9 fig|158879.11.peg.512 Serine acetyltransferase (EC 2.3.1.30)
6 fig|158879.11.peg.513 Cysteinyl-tRNA synthetase (EC 6.1.1.16)
6 fig|158879.11.peg.514 Mini-ribonuclease III ## 23S rRNA maturase
8 fig|158879.11.peg.515 23S rRNA (guanosine(2251)-2'-O)-methyltransferase (EC 2.1.1.185) ## RlmB
5 fig|158879.11.peg.516 Uncharacterized protein YacP, similar to C-terminal domain of ribosome protection-type Tc-resistance proteins
6 fig|158879.11.peg.518 LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-dependent
4 fig|158879.11.peg.520 Transcription termination/antitermination protein NusG


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options

|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions
FIG search