The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.44: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Disulfide bond regulator
Translate Function Assignments



Context on contig NC_002745 from base 47203 to 60068 (12866 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
39 47203 48894 1692 +           Methicillin resistance regulatory sensor-transducer MecR1 gene_name|mecR1, locus|SA0039, protein_id|NP_373279.1, gi|15925746, geneID|1122813
40 48894 49265 372 + -1     1: 2 dlit(1544435) Methicillin resistance repressor MecI gene_name|mecI, locus|SA0040, protein_id|NP_373280.1, gi|15925747, geneID|1122814
41 49773 50882 1110 + 507         Transcriptional regulator, ROK family gene_name|xylR, locus|SA0041, protein_id|NP_373281.1, gi|15925748, geneID|1122815
42 51256 50996 261 - 113 10 1: 1   Polysulfide binding protein locus|SA0042, protein_id|NP_373282.1, gi|15925749, geneID|1122816
43 52252 51392 861 - 135 6 1: 1   Zn-dependent hydroxyacylglutathione hydrolase locus|SA0043, protein_id|NP_373283.1, gi|15925750, geneID|1122817
44 53427 52363 1065 - 110   1: 1   Disulfide bond regulator locus|SA0044, protein_id|NP_373284.1, gi|15925751, geneID|1122818
45 53563 53823 261 + 135 4 1: 1   Uncharacterized protein YrkD locus|SA0045, protein_id|NP_373285.1, gi|15925752, geneID|1122819
46 53838 54467 630 + 14 8 1: 1   UPF0721 transmembrane protein YrkJ locus|SA0046, protein_id|NP_373286.1, gi|15925753, geneID|1122820
47 55468 54806 663 - 338         Mobile element protein locus|SA0047, protein_id|NP_373287.1, gi|15925754, geneID|1122821
48 56002 56733 732 + 533       dlit(3004956)
dlit(2985541)
dlit(10348769)
dlit(11909834)
23S rRNA (adenine(2058)-N(6))-dimethyltransferase (EC 2.1.1.184) => Erm(A) gene_name|ermA, locus|SA0048, protein_id|NP_373288.1, gi|15925755, geneID|1122822
49 57641 56859 783 - 125     1: 3 dlit(10348769)
dlit(3004956)
dlit(2993813)
Aminoglycoside 9-nucleotidyltransferase => ANT(9)-I gene_name|ant(9), locus|SA0049, protein_id|NP_373289.1, gi|15925756, geneID|1122823
50 58169 57792 378 - 150       dlit(10348769)
dlit(3004956)
Mobile element protein gene_name|tnpC, locus|SA0050, protein_id|NP_373290.1, gi|15925757, geneID|1122824
51 60068 58176 1893 - 6       dlit(10348769)
dlit(3004956)
Transposase B from transposon Tn554 gene_name|tnpB, locus|SA0051, protein_id|NP_373291.1, gi|15925758, geneID|1122825

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Disulphide_related_cluster Disulfide bond regulator


  Protein Sequence

>fig|158879.11.peg.44 Disulfide bond regulator
MEQYKEVHINSLNKEELEKLAKMGQLIDVRTKEEYELGHINGSTLHPVEEIKSFNKNSNK
TYYIHCKSGNRSTKACDYLAKQGYDVVNLKGGYKDYEAKNFNSAPLIEKDIEIKENRKQF
DFRGLQCPGPIVNISKEINNISTGEQIEVTVTDPGFNSDIKSWAKQTGNTLVNLTEEANV
INAIIQKEKPKEFEINDTATGTTIVLFSGELDKAVAAMIIANGAKAAGKDVTIFFTFWGL
NALKKAQSTRVKKKGISKMFDLMLPKDPIHMPLSKMNMFGLGNIMMRYVMNKKNVDSLYS
LIDQAIDQDIKLIACTMSMDVMGISKEELRDEVDYGGVGTYIGHTEQANHNLFI

MD5 = 0a97ab778ce0fb110cbe94f028224500


  DNA Sequence

>fig|158879.11.peg.44 Disulfide bond regulator
atggaacaatacaaagaagtacacattaattcattaaacaaagaagaattagaaaaattg
gcaaaaatgggtcaattgattgatgttagaacaaaagaagaatatgaattaggacacatt
aacggttcaactttacacccagtagaagagattaaatcattcaataagaatagcaacaaa
acgtattatatacattgtaaaagcggtaaccgaagcactaaagcttgcgattatttagcc
aaacaaggttatgatgtcgtgaatttaaagggtggatataaagattatgaagcaaagaac
ttcaatagtgctcctttaatagaaaaagatattgaaatcaaagagaatcgtaaacaattt
gattttagaggtcttcagtgccctggacctattgttaatatcagtaaagaaattaacaat
atttcaacgggtgagcaaatcgaggtaacagttacagatcctggtttcaatagtgatatt
aaaagttgggcgaaacaaacagggaatacccttgtaaatcttactgaagaagcaaatgta
attaatgcaattattcaaaaagaaaagccaaaagaatttgaaatcaatgacactgctaca
ggtacaacaattgttttatttagcggtgagttagataaggcagtagcagcaatgatcatc
gcaaatggcgctaaagcagcaggtaaagatgtaactattttctttactttttggggcctc
aacgcattaaaaaaagcgcaatcaactcgcgttaaaaagaaaggtatttccaaaatgttt
gaccttatgttacctaaggatccaatacatatgccattatcaaaaatgaatatgtttgga
ctaggtaatattatgatgcgttatgtaatgaacaagaaaaatgttgattctttatactca
cttatcgatcaagcaatcgatcaagatataaagttaattgcttgtaccatgagtatggat
gttatgggaatttcaaaagaagaattaagagatgaagtcgattatggtggcgtaggtact
tatattggacatactgagcaagcaaatcataacttatttatctaa


  DNA with Flanking Sequence

>fig|158879.11.peg.44 Disulfide bond regulator
aatagctgggtaaataataattgcgcccccaatacctattaatccagatataaatccacc
cagtacgccaattagcaacataatagtcatatttgctatatccattatttacttttaact
aataaattaactgcttcattaattaattcttgagaactttcattattttcttctgctgtt
ttaacgcattctattaaattttcactaattataatccccattaaacgttgtatagaacct
ttagatgcactaagttgcgtaattatatctttgcaatctttttcttcttccatcattttt
acgacaccatttaattgaccttgtattctatttatacgattaatcatttttttatcataa
gtcatattcatttcctccacataaattgattaagttaataataataaattaaaacaaaat
tgtcaaatacccctataggtatttggcaaatgattctatccgttttattataccctcata
ggtatttataggaggtaagtatggaacaatacaaagaagtacacattaattcattaaaca
aagaagaattagaaaaattggcaaaaatgggtcaattgattgatgttagaacaaaagaag
aatatgaattaggacacattaacggttcaactttacacccagtagaagagattaaatcat
tcaataagaatagcaacaaaacgtattatatacattgtaaaagcggtaaccgaagcacta
aagcttgcgattatttagccaaacaaggttatgatgtcgtgaatttaaagggtggatata
aagattatgaagcaaagaacttcaatagtgctcctttaatagaaaaagatattgaaatca
aagagaatcgtaaacaatttgattttagaggtcttcagtgccctggacctattgttaata
tcagtaaagaaattaacaatatttcaacgggtgagcaaatcgaggtaacagttacagatc
ctggtttcaatagtgatattaaaagttgggcgaaacaaacagggaatacccttgtaaatc
ttactgaagaagcaaatgtaattaatgcaattattcaaaaagaaaagccaaaagaatttg
aaatcaatgacactgctacaggtacaacaattgttttatttagcggtgagttagataagg
cagtagcagcaatgatcatcgcaaatggcgctaaagcagcaggtaaagatgtaactattt
tctttactttttggggcctcaacgcattaaaaaaagcgcaatcaactcgcgttaaaaaga
aaggtatttccaaaatgtttgaccttatgttacctaaggatccaatacatatgccattat
caaaaatgaatatgtttggactaggtaatattatgatgcgttatgtaatgaacaagaaaa
atgttgattctttatactcacttatcgatcaagcaatcgatcaagatataaagttaattg
cttgtaccatgagtatggatgttatgggaatttcaaaagaagaattaagagatgaagtcg
attatggtggcgtaggtacttatattggacatactgagcaagcaaatcataacttattta
tctaatcaataaaatctattttaaaaaggagttttttttgtttttcaaacaattttatga
agacaatttttcacaagcatcttatttaattggatgtcaacgtacaggagaagcaatgat
tattgaccctatacgagatttaacaaaatatttaaaagttgcagataaagaaggattcac
aattactaaagctgcagaaacacatattcatgctgattttgcttcaggtattagagatgt
ggcaaataaattgaatgcaagtatatacgtatctgatgaaggtaaagatgaatttaatta
taaaaatatgcctaaacaaacacatttcgttaagcatcaagatattatctatttaggaaa
gattaaattagaagtcttacacactccaggccatccccctgagagtattagttttttact
tactgacgaaggtgggggttccagtataccaatgggattatttagcggtgacttcatctt
tgttggtgatgtaggtagaccagat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005515       F:protein binding
GO:0005737       C:cytoplasm
GO:0008033       P:tRNA processing
GO:0016783       F:sulfurtransferase activity
cmr|NT01SA0047 Staphylococcus aureus N315     Uncharacterized protein family UPF0033 family
cmr|NT02SA0045 Staphylococcus aureus Mu50     unnamed protein product; ORF6
cmr|NT08SA0045 Staphylococcus aureus subsp. aureus MRSA252     unnamed protein product; ORF6
cmr|SERP2515 Staphylococcus epidermidis RP62A     rhodanese-like domain protein
dbj|BAA82211.1 Staphylococcus aureus     unnamed protein product
dbj|BAB41262.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB47615.1 Staphylococcus aureus     hypothetical protein
dbj|BAB56209.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAC57483.1 Staphylococcus aureus     hypothetical protein
dbj|BAF76929.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
dbj|BAH66408.1 Staphylococcus aureus     hypothetical protein
emb|CAG39074.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   hypothetical protein
emb|CAH17604.1 Staphylococcus aureus EMBL   hypothetical protein
emb|CAP17716.1 Staphylococcus pseudintermedius EMBL   hypothetical protein
emb|CAP17745.1 Staphylococcus pseudintermedius EMBL   hypothetical protein
emb|CAQ43018.1 Staphylococcus aureus EMBL   hypothetical protein
fig|158878.1.peg.47 Staphylococcus aureus subsp. aureus Mu50 FIG   Disulfide bond regulator
fig|158878.14.peg.44 Staphylococcus aureus subsp. aureus Mu50 FIG   Disulfide bond regulator
fig|158879.1.peg.46 Staphylococcus aureus subsp. aureus N315 FIG   Disulfide bond regulator
fig|176279.3.peg.2447 Staphylococcus epidermidis RP62A FIG   Disulfide bond regulator
fig|176279.9.peg.2435 Staphylococcus epidermidis RP62A FIG   Disulfide bond regulator
fig|282458.1.peg.42 Staphylococcus aureus subsp. aureus MRSA252 FIG   Disulfide bond regulator
fig|282458.4.peg.44 Staphylococcus aureus subsp. aureus MRSA252 FIG   Disulfide bond regulator
fig|359786.13.peg.70 Staphylococcus aureus subsp. aureus JH9 FIG   Disulfide bond regulator
fig|359786.3.peg.2028 Staphylococcus aureus subsp. aureus JH9 FIG   Disulfide bond regulator
fig|359787.11.peg.68 Staphylococcus aureus subsp. aureus JH1 FIG   Disulfide bond regulator
fig|359787.3.peg.1001 Staphylococcus aureus subsp. aureus JH1 FIG   Disulfide bond regulator
fig|418127.4.peg.39 Staphylococcus aureus subsp. aureus Mu3 FIG   Disulfide bond regulator
fig|418127.6.peg.43 Staphylococcus aureus subsp. aureus Mu3 FIG   Disulfide bond regulator
fig|546342.3.peg.2639 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Disulfide bond regulator
fig|546343.3.peg.1538 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Disulfide bond regulator
fig|553565.3.peg.1900 Staphylococcus aureus A5937 FIG   Disulfide bond regulator
fig|553567.3.peg.2651 Staphylococcus aureus A5948 FIG   Disulfide bond regulator
fig|553568.3.peg.1549 Staphylococcus aureus A6224 FIG   Disulfide bond regulator
fig|553577.3.peg.2738 Staphylococcus aureus A8796 FIG   Disulfide bond regulator
fig|553580.3.peg.2830 Staphylococcus aureus A8819 FIG   Disulfide bond regulator
fig|553588.3.peg.2353 Staphylococcus aureus A9719 FIG   Disulfide bond regulator
fig|553592.3.peg.326 Staphylococcus aureus A9763 FIG   Disulfide bond regulator
fig|553596.3.peg.2381 Staphylococcus aureus A9781 FIG   Disulfide bond regulator
fig|553601.3.peg.2726 Staphylococcus aureus A10102 FIG   Disulfide bond regulator
fig|585154.3.peg.2838 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Disulfide bond regulator
fig|585891.3.peg.44 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Disulfide bond regulator
fig|703339.3.peg.45 Staphylococcus aureus 04-02981 FIG   Disulfide bond regulator
gb|AAW53301.1 Staphylococcus epidermidis RP62A     rhodanese-like domain protein
gb|ABQ47847.1 Staphylococcus aureus subsp. aureus JH9     Rhodanese domain protein
gb|ABR50901.1 Staphylococcus aureus subsp. aureus JH1     Rhodanese domain protein
gb|ACM17500.1 Staphylococcus aureus     rhodanese-like domain protein
gb|EEV27767.1 Staphylococcus aureus A9781     rhodanese domain-containing protein
gb|EEV65656.1 Staphylococcus aureus A9763     rhodanese domain-containing protein
gb|EEV66421.1 Staphylococcus aureus A9719     rhodanese domain-containing protein
gb|EEV80405.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV82033.1 Staphylococcus aureus A5948     rhodanese domain-containing protein
gb|EEV85467.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|13699963 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14020991 Staphylococcus aureus NCBI   hypothetical protein
gi|14245814 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147739549 Staphylococcus aureus subsp. aureus JH9 NCBI   Rhodanese domain protein
gi|148266480 Staphylococcus aureus subsp. aureus JH9 NCBI   rhodanese domain-containing protein
gi|149944965 Staphylococcus aureus subsp. aureus JH1 NCBI   Rhodanese domain protein
gi|150392513 Staphylococcus aureus subsp. aureus JH1 NCBI   rhodanese domain-containing protein
gi|156720512 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156978377 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0046
gi|15923037 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0047
gi|15925751 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0044
gi|169403115 Staphylococcus pseudintermedius NCBI   hypothetical protein
gi|169403145 Staphylococcus pseudintermedius NCBI   hypothetical protein
gi|195963193 Staphylococcus aureus NCBI   hypothetical protein
gi|221139584 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_13219
gi|221141502 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_07658
gi|221327656 Staphylococcus aureus NCBI   rhodanese-like domain protein
gi|238773845 Staphylococcus aureus NCBI   hypothetical protein
gi|254663976 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00220
gi|257789427 Staphylococcus aureus A9781 NCBI   rhodanese domain-containing protein
gi|257795455 Staphylococcus aureus A9781 NCBI   rhodanese domain-containing protein
gi|257841209 Staphylococcus aureus A9763 NCBI   rhodanese domain-containing protein
gi|257841991 Staphylococcus aureus A9719 NCBI   rhodanese domain-containing protein
gi|257857508 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257859177 Staphylococcus aureus A5948 NCBI   rhodanese domain-containing protein
gi|257862700 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258407200 Staphylococcus aureus A9763 NCBI   rhodanese domain-containing protein
gi|258422016 Staphylococcus aureus A9719 NCBI   rhodanese domain-containing protein
gi|258449234 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258453143 Staphylococcus aureus A5948 NCBI   rhodanese domain-containing protein
gi|258455141 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|28465866 Staphylococcus aureus NCBI   hypothetical protein
gi|49240424 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein
gi|49482295 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR0046
gi|5360841 Staphylococcus aureus NCBI   unnamed protein product
gi|57636513 Staphylococcus epidermidis RP62A NCBI   rhodanese-like domain protein
gi|57865855 Staphylococcus epidermidis RP62A NCBI   rhodanese-like domain-containing protein
gi|62815953 Staphylococcus aureus NCBI   hypothetical protein
img|637091643 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098546 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637153523 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637169188 Staphylococcus epidermidis RP62A IMG   rhodanese-like domain protein
img|639107642 Staphylococcus aureus aureus JH1 IMG   SirA-like:Rhodanese-like
img|640564370 Staphylococcus aureus aureus JH9 IMG   Rhodanese domain protein
img|640778109 Staphylococcus aureus aureus JH1 IMG   Rhodanese domain protein
img|640902768 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_0035 Staphylococcus aureus subsp. aureus JH1 KEGG   rhodanese domain-containing protein
kegg|saj:SaurJH9_0035 Staphylococcus aureus subsp. aureus JH9 KEGG   rhodanese domain-containing protein
kegg|sar:SAR0046   KEGG   hypothetical protein
kegg|sau:SA0044   KEGG   hypothetical protein
kegg|sav:SAV0047   KEGG   hypothetical protein
kegg|saw:SAHV_0046 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|ser:SERP2515 Staphylococcus epidermidis RP62A KEGG   rhodanese-like domain-containing protein
ref|NP_370571.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0047
ref|NP_373284.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0044
ref|YP_001245423.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   rhodanese domain-containing protein
ref|YP_001315188.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   rhodanese domain-containing protein
ref|YP_001440636.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0046
ref|YP_039519.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR0046
ref|YP_190057.1 Staphylococcus epidermidis RP62A RefSeq   rhodanese-like domain-containing protein
ref|ZP_03564383.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_13219
ref|ZP_03565995.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_07658
ref|ZP_05143448.1 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00220
ref|ZP_05644434.1 Staphylococcus aureus A9781 RefSeq   rhodanese domain-containing protein
ref|ZP_05680347.1 Staphylococcus aureus A9763 RefSeq   rhodanese domain-containing protein
ref|ZP_05684935.1 Staphylococcus aureus A9719 RefSeq   rhodanese domain-containing protein
ref|ZP_05697338.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05701135.1 Staphylococcus aureus A5948 RefSeq   rhodanese domain-containing protein
ref|ZP_05703102.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5INS4 Staphylococcus aureus (strain JH9) TrEMBL   Rhodanese domain protein
tr|A6TXI3 Staphylococcus aureus (strain JH1) TrEMBL   Rhodanese domain protein
tr|A7WWV8 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|B1GVD6 Staphylococcus pseudintermedius TrEMBL   Putative uncharacterized protein
tr|Q5HK36 Staphylococcus epidermidis (strain ATCC 35984 / RP62A) TrEMBL   Rhodanese-like domain protein
tr|Q6GKQ3 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q7A303 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein
tr|Q7A8C3 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0044
tr|Q9XB85 Staphylococcus aureus TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
10 fig|158879.11.peg.42 Polysulfide binding protein
6 fig|158879.11.peg.43 Zn-dependent hydroxyacylglutathione hydrolase
4 fig|158879.11.peg.45 Uncharacterized protein YrkD
8 fig|158879.11.peg.46 UPF0721 transmembrane protein YrkJ


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search