The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.349: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Ferrous iron transport permease EfeU
Translate Function Assignments



Context on contig NC_002745 from base 385092 to 398577 (13486 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
342 385092 386153 1062 +           Luciferase-like monooxygenase YhbW locus|SA0327, protein_id|NP_373573.1, gi|15926040, geneID|1123106
343 386167 386733 567 + 13     1: 6   NADPH-dependent FMN reductase family protein locus|SA0328, protein_id|NP_373574.1, gi|15926041, geneID|1123107
344 387787 386792 996 - 58         Putative membrane protein YeiH locus|SA0329, protein_id|NP_373575.1, gi|15926042, geneID|1123108
345 387786 388139 354 + -2         hypothetical protein  
346 388152 388697 546 + 12     2: 5 4   Ribosomal-protein-L7p-serine acetyltransferase locus|SA0330, protein_id|NP_373576.1, gi|15926043, geneID|1123109
347 388964 389818 855 + 266     1: 1   Ferrous iron transport periplasmic protein EfeO, contains peptidase-M75 domain and (frequently) cupredoxin-like domain locus|SA0331, protein_id|NP_373577.1, gi|15926044, geneID|1123110
348 389815 391044 1230 + -4     1: 1   Ferrous iron transport peroxidase EfeB locus|SA0332, protein_id|NP_373578.1, gi|15926045, geneID|1123111
349 391025 392737 1713 + -20     1: 1   Ferrous iron transport permease EfeU locus|SA0333, protein_id|NP_373579.1, gi|15926046, geneID|1123112
350 393457 392978 480 - 240     2: 3 2   Twin-arginine translocation protein TatC locus|SA0334, protein_id|NP_373580.1, gi|15926047, geneID|1123113
351 393911 393696 216 - 238     2: 3 2   Twin-arginine translocation protein TatA locus|SA0335, protein_id|NP_373581.1, gi|15926048, geneID|1123114
352 394408 394019 390 - 107         FIG01108269: hypothetical protein locus|SA0336, protein_id|NP_373582.1, gi|15926049, geneID|1123115
353 394648 394851 204 + 239         Transcriptional regulator SERP0029, Xre family locus|SA0337, protein_id|NP_373583.1, gi|15926050, geneID|1123116
354 394848 395561 714 + -4         FIG01108133: hypothetical protein locus|SA0338, protein_id|NP_373584.1, gi|15926051, geneID|1123117
355 395586 396428 843 + 24         Efflux ABC transporter, ATP-binding protein SAV0351 locus|SA0339, protein_id|NP_373585.1, gi|15926052, geneID|1123118
356 396428 397057 630 + -1         Efflux ABC transporter, permease protein SAV0352 locus|SA0340, protein_id|NP_373586.1, gi|15926053, geneID|1123119
357 398577 397444 1134 - 386         Low temperature requirement protein A locus|SA0341, protein_id|NP_373587.1, gi|15926054, geneID|1123120

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Ferrous_iron_transporter_EfeUOB,_low-pH-induced SvetaG Ferrous iron transport permease EfeU


  Protein Sequence

>fig|158879.11.peg.349 Ferrous iron transport permease EfeU
MKHYLTKFVAMLITAAMVCSFGLLKSQAAEQQSISDVYSVITDAKSALSNNSISNDNKQK
AIEQVVSAVKKLSLEDNSEGNAVKSDVRKLEDAKANDNQKDTLSQLTKSLIAYEEKLASK
DAGSKIKLLQQQVDAKDAAMTKAIKDKNKAELESLNNSLNQIWTSNETVIRNYDANQYGQ
IEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSDTSANDQYHVSQLNDALEKA
IKAIDDNQLSDADAALTHFIEIWPYVEGQIQTKDGALYTKIEDKIPYYQSVLDEHNKSHV
KDGLVDINNQIKEVVGHSYSFVDVMIIFLREGLEVLLIVMTLTTMTRKVKDNKGTASVIG
GAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVAVILMFIVGVWMHKRSNAKRWND
MIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFYMGMIGELATKDFIIGIALAIVIL
IVFAVLFRFIVRLIPIFYIFRVLSIFIFIMGFKMLGVSIQKLQLLGAMPRHVIEGFPTIN
WLGFYPSYEPLIAQAAYIMVVAILIFKFKK

MD5 = 1f6f6bcbcf856a9c806923915fcffe6c


  DNA Sequence

>fig|158879.11.peg.349 Ferrous iron transport permease EfeU
gtgaaacattatttgactaaatttgtagcaatgctaataactgctgctatggtgtgtagc
tttgggttactgaaaagtcaggcagcagaacaacaaagtattagtgatgtatatagtgtg
ataacggatgcgaaatctgcactttctaataattcgatatcgaatgacaataagcagaaa
gcaattgagcaagtggtaagtgcagttaagaaattatcgcttgaagataatagtgaaggt
aatgctgtcaaatcagatgtgagaaagcttgaagatgcaaaagcgaatgataatcaaaaa
gatacactttcgcaattaacgaagtcattaattgcttatgaagagaaattggctagtaaa
gatgcgggttctaaaattaaactattgcaacagcaagtcgatgccaaagatgctgcgatg
acaaaagcgattaaagataaaaataaagcggaattagaatctttgaacaatagtttgaat
cagatttggacaagtaatgaaacagtgattcgcaattatgacgcaaatcaatatggacaa
attgaagtcgcattattacaacttagaattgcaattcataagtcaccattagatacggca
aaagtgtcacatgcttggacaacttttaaatcaaatattgatcatgtcgataaaaaaagt
gatacgtctgcaaatgatcaataccatgtatcacaattaaatgatgcgttagagaaggcg
attaaagctatcgacgacaatcaattgtcggatgctgatgctgcgcttacacattttata
gaaatttggccgtatgttgaaggtcaaattcaaactaaagacggggctttgtatacgaaa
attgaagataaaataccatattatcaaagtgtattagacgaacataataaatcgcatgtc
aaagatggtttagtagatataaacaatcaaattaaagaggttgttggccatagttatagc
tttgtcgatgtgatgattatctttttacgtgaaggactagaagtgttattaattgtaatg
acattgactaccatgacgcgtaaagtcaaagataataaggggactgcaagtgtgattggt
ggtgcaattgccggacttgtactgagtattatcttagcaattacgtttgtagaaacttta
gggaatagtggcattcttcgtgaaagtatggaagcgggattaggtatcgttgcggtcata
ttaatgtttatcgttggtgtttggatgcacaaacgttcaaatgcgaaacgctggaatgat
atgattaaaaatatgtatgccaatgcgattagtaatggtaatttggtattgttagcgacg
attggtttaatatctgtgttgcgtgaaggtgttgaggttatcattttctatatggggatg
ataggtgagctagcgacaaaagattttattattggtattgccttggccatagtgatatta
attgtctttgcggtattatttagatttatcgtcagattgatacctatattctatatattt
agagtattgtcgatctttatttttattatgggattcaaaatgcttggcgtaagtattcaa
aagttacaattattaggtgcgatgccaagacatgttattgaaggattcccaacgattaac
tggttgggcttctatccaagttatgaaccattgatagcacaagctgcttatattatggta
gttgctatcttaatctttaaatttaaaaaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.349 Ferrous iron transport permease EfeU
tagaaagagtaatcaacttaaagattatgtgtttattgatgacggatgggcgaaacatgg
aacttattgtgttgtcagacgtattcaaatacacattgaaacgtgggatcgtactgcact
ggaagaacaagaggctacatttggtcggaaacgacatagtggtgcgccgttaacaggtgg
gaaagagtttgatgaaattgacttaaaagcgaaagatagtcatggcgagtatattattga
taaagatgcccatacgagactagcgaaagaagcaaatacgtcaattttacgtagagcctt
taattatgttgatggtacggatgaccgcacaggtaacttcgaaacaggcttgttgttcat
tgcttttcaaaaagcgacaaaacaatttatcgatatacaaaataatttaggtagtaatga
taaattaaatgaatatattacacatagaggttctgcttcatttttagtattaccaggtgt
tagtaagggaggataccttggtgaaacattatttgactaaatttgtagcaatgctaataa
ctgctgctatggtgtgtagctttgggttactgaaaagtcaggcagcagaacaacaaagta
ttagtgatgtatatagtgtgataacggatgcgaaatctgcactttctaataattcgatat
cgaatgacaataagcagaaagcaattgagcaagtggtaagtgcagttaagaaattatcgc
ttgaagataatagtgaaggtaatgctgtcaaatcagatgtgagaaagcttgaagatgcaa
aagcgaatgataatcaaaaagatacactttcgcaattaacgaagtcattaattgcttatg
aagagaaattggctagtaaagatgcgggttctaaaattaaactattgcaacagcaagtcg
atgccaaagatgctgcgatgacaaaagcgattaaagataaaaataaagcggaattagaat
ctttgaacaatagtttgaatcagatttggacaagtaatgaaacagtgattcgcaattatg
acgcaaatcaatatggacaaattgaagtcgcattattacaacttagaattgcaattcata
agtcaccattagatacggcaaaagtgtcacatgcttggacaacttttaaatcaaatattg
atcatgtcgataaaaaaagtgatacgtctgcaaatgatcaataccatgtatcacaattaa
atgatgcgttagagaaggcgattaaagctatcgacgacaatcaattgtcggatgctgatg
ctgcgcttacacattttatagaaatttggccgtatgttgaaggtcaaattcaaactaaag
acggggctttgtatacgaaaattgaagataaaataccatattatcaaagtgtattagacg
aacataataaatcgcatgtcaaagatggtttagtagatataaacaatcaaattaaagagg
ttgttggccatagttatagctttgtcgatgtgatgattatctttttacgtgaaggactag
aagtgttattaattgtaatgacattgactaccatgacgcgtaaagtcaaagataataagg
ggactgcaagtgtgattggtggtgcaattgccggacttgtactgagtattatcttagcaa
ttacgtttgtagaaactttagggaatagtggcattcttcgtgaaagtatggaagcgggat
taggtatcgttgcggtcatattaatgtttatcgttggtgtttggatgcacaaacgttcaa
atgcgaaacgctggaatgatatgattaaaaatatgtatgccaatgcgattagtaatggta
atttggtattgttagcgacgattggtttaatatctgtgttgcgtgaaggtgttgaggtta
tcattttctatatggggatgataggtgagctagcgacaaaagattttattattggtattg
ccttggccatagtgatattaattgtctttgcggtattatttagatttatcgtcagattga
tacctatattctatatatttagagtattgtcgatctttatttttattatgggattcaaaa
tgcttggcgtaagtattcaaaagttacaattattaggtgcgatgccaagacatgttattg
aaggattcccaacgattaactggttgggcttctatccaagttatgaaccattgatagcac
aagctgcttatattatggtagttgctatcttaatctttaaatttaaaaaataaaaaacag
gccgagtgcctgtttttttgttgctgtattgcggattatcgtagcattgttgagatgtgg
atatcgctgcatggttggttctcgttgtattgcagatatcacggtttaatccgattctgt
attctaattaacgcaagtgcagtattgatataatctgaggtgctacattgttcttttatt
ggctattgtgatgttgctgcattgtgagtatcacagcattaattcgtataaggttaatgt
gttggcggtttgcctcggcatgtgaacttaacaatgaacatactgaactcaaagagcaat
atgagtggcaatgtaagtaatatatttaatgttaaatcgggtggtgcaatgatacttgcc
agcacaaagcaagcgaaataaatatattttcgataatgcttcaatgatgtgatatctata
agaccgaattttgcaagtcctatgaataatattggcaattggaataaaatgccaaaagtg
aaaagccaacgga


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|158878.14.peg.349 Staphylococcus aureus subsp. aureus Mu50 FIG   Ferrous iron transport permease EfeU
fig|359786.13.peg.438 Staphylococcus aureus subsp. aureus JH9 FIG   Ferrous iron transport permease EfeU
fig|359786.3.peg.2204 Staphylococcus aureus subsp. aureus JH9 FIG   Ferrous iron transport permease EfeU
fig|359787.11.peg.431 Staphylococcus aureus subsp. aureus JH1 FIG   Ferrous iron transport permease EfeU
fig|359787.3.peg.552 Staphylococcus aureus subsp. aureus JH1 FIG   Ferrous iron transport permease EfeU
fig|418127.6.peg.348 Staphylococcus aureus subsp. aureus Mu3 FIG   Ferrous iron transport permease EfeU
fig|505321.3.peg.2089 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Ferrous iron transport permease EfeU
fig|548474.3.peg.1745 Staphylococcus aureus subsp. aureus TCH130 FIG   Ferrous iron transport permease EfeU
fig|553565.3.peg.2665 Staphylococcus aureus A5937 FIG   Ferrous iron transport permease EfeU
fig|553568.3.peg.383 Staphylococcus aureus A6224 FIG   Ferrous iron transport permease EfeU
fig|553571.3.peg.31 Staphylococcus aureus A6300 FIG   Ferrous iron transport permease EfeU
fig|553577.3.peg.1591 Staphylococcus aureus A8796 FIG   Ferrous iron transport permease EfeU
fig|553580.3.peg.756 Staphylococcus aureus A8819 FIG   Ferrous iron transport permease EfeU
fig|553581.3.peg.1349 Staphylococcus aureus A9299 FIG   Ferrous iron transport permease EfeU
fig|553588.3.peg.1658 Staphylococcus aureus A9719 FIG   Ferrous iron transport permease EfeU
fig|553592.3.peg.1853 Staphylococcus aureus A9763 FIG   Ferrous iron transport permease EfeU
fig|553596.3.peg.1948 Staphylococcus aureus A9781 FIG   Ferrous iron transport permease EfeU
fig|553601.3.peg.1001 Staphylococcus aureus A10102 FIG   Ferrous iron transport permease EfeU
fig|585891.3.peg.348 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Ferrous iron transport permease EfeU
fig|680649.3.peg.503 Staphylococcus aureus subsp. aureus MR1 FIG   Ferrous iron transport permease EfeU
fig|681288.4.peg.317 Staphylococcus aureus subsp. aureus ED98 FIG   Ferrous iron transport permease EfeU
gb|ABQ48199.1 Staphylococcus aureus subsp. aureus JH9     High-affinity Fe2+/Pb2+ permease-like protein
gb|ABR51265.1 Staphylococcus aureus subsp. aureus JH1     high-affinity iron transporter
gb|EES95616.1 Staphylococcus aureus subsp. aureus TCH130     OFeT family oxidase-dependent iron (Fe2+) transporter
gi|147739901 Staphylococcus aureus subsp. aureus JH9 NCBI   High-affinity Fe2+/Pb2+ permease-like protein
gi|148266832 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0393
gi|149945329 Staphylococcus aureus subsp. aureus JH1 NCBI   high-affinity iron transporter
gi|150392877 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0403
gi|253316554 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_10495
gi|253726887 Staphylococcus aureus subsp. aureus TCH130 NCBI   OFeT family oxidase-dependent iron (Fe2+) transporter
gi|253735087 Staphylococcus aureus subsp. aureus TCH130 NCBI   OFeT family oxidase-dependent iron (Fe2+) transporter
gi|255005140 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_01695
img|639108692 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640564722 Staphylococcus aureus aureus JH9 IMG   High-affinity Fe2+/Pb2+ permease-like protein
img|640778473 Staphylococcus aureus aureus JH1 IMG   high-affinity iron transporter
kegg|sah:SaurJH1_0403 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0393 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
ref|YP_001245775.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0393
ref|YP_001315552.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0403
ref|ZP_04839767.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_10495
ref|ZP_04869252.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   OFeT family oxidase-dependent iron (Fe2+) transporter
ref|ZP_05143741.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_01695
tr|A5IPS6 Staphylococcus aureus (strain JH9) TrEMBL   High-affinity Fe2+/Pb2+ permease-like protein precursor
tr|A6TYJ7 Staphylococcus aureus (strain JH1) TrEMBL   High-affinity iron transporter precursor
tr|C5Q533 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   OFeT family oxidase-dependent iron (Fe2+) transporter


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search