The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2727: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7)
Translate Function Assignments



Context on contig NC_003140 from base 8897 to 21206 (12310 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2721 8897 10654 1758 +       1: 1   Beta-lactamase regulatory sensor-transducer BlaR1 gene_name|blaR1, locus|SAP011, protein_id|NP_395547.1, gi|16119211, geneID|1122764
2722 10644 11024 381 + -11     2: 1 9   beta-lactamase repressor BlaI gene_name|blaI, locus|SAP012, protein_id|NP_395548.1, gi|16119212, geneID|1122763
2723 11288 11881 594 + 263     1: 1   Phage DNA invertase; Resolvase/integrase Bin gene_name|binL, locus|SAP013, protein_id|NP_395549.1, gi|16119213, geneID|1122762
2724 11853 13295 1443 + -29     1: 1   Tn552 transposase gene_name|tnp, locus|SAP014, protein_id|NP_395550.1, gi|16119214, geneID|1122771
2725 13288 14046 759 + -8     1: 1   Replication initiation ATPase; ATP-binding protein p271 gene_name|sin, locus|SAP015, protein_id|NP_395551.1, gi|16119215, geneID|1122770
2726 14107 14421 315 + 60 4 1: 2   Arsenical resistance operon repressor gene_name|arsR, locus|SAP016, protein_id|NP_395552.1, gi|16119216, geneID|1122761
2727 14421 15710 1290 + -1   1: 2   Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7) gene_name|arsB, locus|SAP017, protein_id|NP_395553.1, gi|16119217, geneID|1122759
2728 15728 16123 396 + 17 5 4: 3 5 2 8 dlit(1409657)
dlit(8003493)
dlit(11573087)
Arsenate reductase (EC 1.20.4.4) thioredoxin-coupled, LMWP family gene_name|arsC, locus|SAP018, protein_id|NP_395554.1, gi|16119218, geneID|1122760
2729 16503 16796 294 + 379         FIG01108898: hypothetical protein locus|SAP019, protein_id|NP_395555.1, gi|16119219, geneID|1122747
2730 16871 18805 1935 + 74         immunity protein, probable locus|SAP020, protein_id|NP_395556.1, gi|16119220, geneID|1122748
2731 18809 19120 312 + 3         FIG01109643: hypothetical protein locus|SAP021, protein_id|NP_395557.1, gi|16119221, geneID|1122749
2732 19132 19758 627 + 11     3: 7 6 4   ABC transporter, ATP-binding protein locus|SAP022, protein_id|NP_395558.1, gi|16119222, geneID|1122750
2733 19996 20373 378 + 237         Plasmid recombination enzyme # fragment locus|SAP023, protein_id|NP_395559.1, gi|16119223, geneID|1122751
2734 20382 20639 258 + 8         Plasmid recombination, MobE mobilization protein locus|SAP024, protein_id|NP_395560.1, gi|16119224, geneID|1122752
2735 20706 21206 501 + 66         truncated Pre protein locus|SAP025, protein_id|NP_395561.1, gi|16119225, geneID|1122753

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Arsenic_resistance VeronikaV Arsenic efflux pump protein


  Protein Sequence

>fig|158879.11.peg.2727 Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7)
MTILAIVIFLLTLTFVIWQPKGLDIGITALIGAVVAIITGVVSLSDVLEVTGIVWNATLT
FVAVILISLILDEIGFFEWSAIHMVKASNGNGLKMFVFIMLLGAIVAAFFANDGAALILT
PIVLAMVRNLGFNQKVIFPFIIASGFIADTTSLPLIVSNLVNIVSADYFDIGFIEYFSRM
IIPNIFSLIASILVLWLYFRKSIPKTFDTENLSDPKSAIKDSKLFKLSWIVLAVLLVGYL
VSEFIQIPVSIIAGIIAFIFVILARKSKAVHTKQVIKGAPWNIVVFSIGMYLVVFGLKNV
GITTVLGDVLTNISNYGLFSSIMGMGFIAAFLSSIMNNMPTVLIDAIAIGQSSATGILKE
GMVYANVIGSDLGPKITPIGSLATLLWLHVLTQKGVKISWGTYFKTGIIITIPVLFVTLL
GLYLTLIIF

MD5 = 9300f9bd43266ada5a6d77184311b5cd


  DNA Sequence

>fig|158879.11.peg.2727 Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7)
atgactattttagcaattgtaatttttcttttaactttaacctttgtgatttggcaacca
aaaggtttagatattggtattacagctttaattggagcggttgttgctatcattacagga
gtcgtaagtctttctgatgtattagaagtaacaggtattgtttggaatgcaactttaact
tttgtggctgttattcttatttcattaatattagatgaaattggtttttttgaatggtct
gcgatacatatggtcaaggcttcaaacggtaatggcttaaaaatgtttgtttttattatg
ttacttggggcaattgtagcagcatttttcgcaaatgatggtgcagctttaatcttaacg
cctattgtattagcgatggtaaggaatctaggatttaatcaaaaagtgattttccccttt
attattgccagtggttttattgctgatactacatcacttcccttaattgtaagtaactta
gttaatatcgtttctgcagattacttcgatattggatttattgaatattttagccgaatg
atcattcctaatatattctctctgattgctagtattctcgttttatggttatatttcaga
aaatccatacctaaaacgttcgatacagaaaatctatcagatcctaaaagtgcaattaaa
gattctaagttatttaagctttcatggatagtattagcagtactactcgttggatatctt
gttagcgagtttatccaaattcctgtatcaattattgctggtattattgcttttatcttt
gtaatattagctcgtaaatctaaagcagttcatacaaaacaagtgattaaaggtgcacca
tggaatatcgttgtattctctattggtatgtatcttgttgtgtttggactaaaaaatgta
ggtattacaacggtccttggggatgttttaacaaacatttcaaattatgggttatttagc
agcatcatgggtatgggctttatagctgctttcttatcttcgattatgaacaacatgcca
actgttttaatagatgcaatagcgattggccaatccagtgctacaggaatattaaaagaa
ggcatggtttatgcgaatgtcataggttctgatttaggacctaaaattacgccaattggt
tctttagcaacattattgtggctacatgtcttaacacaaaaaggtgtgaagatttcgtgg
ggaacatactttaaaactggaattatcatcactattccagtcctatttgtaacactctta
ggtttataccttacactaatcatattttaa


  DNA with Flanking Sequence

>fig|158879.11.peg.2727 Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7)
ccacaaaagcgtttagtttattaccgagttgttgaattacttgaacagggtaaatctata
agtactatagctaaagaagttggtattacacgtcaaactatatatagaataaaaaatagt
aaataaaataacatagacaataatctatatagatgttaatctatttaatatctaggaggt
ttattcatgtcttataaagaactatcaacaatattaaaaattttatcagatccaagtagg
ttagaaatattagatttactttcttgtggtgagctatgcgcttgtgacttattagaacac
tttcaattctcacaacctacactaagtcatcatatgaagtcattagtagataatgaatta
gttacaacacgaaaagatggcaataaacattggtatcaacttaatcatgctattttagat
gatattatccaaaacttgaacatcattaatacatctaatcaaagatgtgtatgtaaaaat
gtgaaatcaggtgactgttgatgactattttagcaattgtaatttttcttttaactttaa
cctttgtgatttggcaaccaaaaggtttagatattggtattacagctttaattggagcgg
ttgttgctatcattacaggagtcgtaagtctttctgatgtattagaagtaacaggtattg
tttggaatgcaactttaacttttgtggctgttattcttatttcattaatattagatgaaa
ttggtttttttgaatggtctgcgatacatatggtcaaggcttcaaacggtaatggcttaa
aaatgtttgtttttattatgttacttggggcaattgtagcagcatttttcgcaaatgatg
gtgcagctttaatcttaacgcctattgtattagcgatggtaaggaatctaggatttaatc
aaaaagtgattttcccctttattattgccagtggttttattgctgatactacatcacttc
ccttaattgtaagtaacttagttaatatcgtttctgcagattacttcgatattggattta
ttgaatattttagccgaatgatcattcctaatatattctctctgattgctagtattctcg
ttttatggttatatttcagaaaatccatacctaaaacgttcgatacagaaaatctatcag
atcctaaaagtgcaattaaagattctaagttatttaagctttcatggatagtattagcag
tactactcgttggatatcttgttagcgagtttatccaaattcctgtatcaattattgctg
gtattattgcttttatctttgtaatattagctcgtaaatctaaagcagttcatacaaaac
aagtgattaaaggtgcaccatggaatatcgttgtattctctattggtatgtatcttgttg
tgtttggactaaaaaatgtaggtattacaacggtccttggggatgttttaacaaacattt
caaattatgggttatttagcagcatcatgggtatgggctttatagctgctttcttatctt
cgattatgaacaacatgccaactgttttaatagatgcaatagcgattggccaatccagtg
ctacaggaatattaaaagaaggcatggtttatgcgaatgtcataggttctgatttaggac
ctaaaattacgccaattggttctttagcaacattattgtggctacatgtcttaacacaaa
aaggtgtgaagatttcgtggggaacatactttaaaactggaattatcatcactattccag
tcctatttgtaacactcttaggtttataccttacactaatcatattttaagaaaaggggc
tttaattatggataagaaaacaatttattttatatgtacaggaaactcttgtcgtagcca
aatggctgaaggttggggaaaggaaatattgggtgaaggttggaatgtctattctgctgg
tattgaaacacatggtgttaatcctaaagcaatagaagctatgaaagaagtagatattga
tatatcaaaccatacgtcagacttgattgataatgatattttaaaacaatcagatttggt
cgtaacgttatgtagtgatgcagacaataattgtcctattttaccaccaaacgttaaaaa
agagcattggggttttgatgatccagcaggtaaagaatggtcagaattccaacgtgttag
agacgagattaaattagctatagaaaagtttaaattgagataatcataaacacctcttat
ttagttaataagaggtgttttgccatttaaagaacaaaatttgtgccatatacaatatgc
cctctctttt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0015105       F:arsenite transmembrane transporter activity
GO:0016021       C:integral to membrane
cmr|NT01SAA0020 Staphylococcus aureus N315     arsenical pump membrane protein
dbj|BAB43886.1 Staphylococcus aureus subsp. aureus N315     arsenic efflux pump protein
dbj|BAG12262.1 Staphylococcus aureus     arsenic efflux pump protein
fig|158879.1.peg.2610 Staphylococcus aureus subsp. aureus N315 FIG   Arsenite/antimonite:H+ antiporter ArsB (EC 7.3.2.7)
gi|13774156 Staphylococcus aureus subsp. aureus N315 NCBI   arsenic efflux pump protein
gi|16119217 Staphylococcus aureus subsp. aureus N315 NCBI   arsenic efflux pump protein
gi|169264769 Staphylococcus aureus NCBI   arsenic efflux pump protein
gi|170780428 Staphylococcus aureus NCBI   arsenic efflux pump protein
img|637199104 Staphylococcus aureus aureus N315 IMG   arsenic efflux pump protein
img|642482799 Staphylococcus aureus plasmid pTZ2162 IMG   arsenic efflux pump protein
kegg|sau:SAP017   KEGG   arsenic efflux pump protein
ref|NP_395553.1 Staphylococcus aureus subsp. aureus N315 RefSeq   arsenic efflux pump protein
ref|YP_001715972.1 Staphylococcus aureus RefSeq   arsenic efflux pump protein
tr|B1B3K8 Staphylococcus aureus TrEMBL   Arsenic efflux pump protein
tr|Q9AC73 Staphylococcus aureus (strain N315) TrEMBL   Arsenic efflux pump protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|158879.11.peg.2726 Arsenical resistance operon repressor
5 fig|158879.11.peg.2728 Arsenate reductase (EC 1.20.4.4) thioredoxin-coupled, LMWP family


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search