The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2704: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Chromosome (plasmid) partitioning protein ParB-2
Translate Function Assignments



Context on contig NC_002745 from base 2803193 to 2814602 (11410 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2696 2803193 2803951 759 +       2: 13 6   transporter, ATP-binding protein SERP0021 gene_name|vraD, locus|SA2492, protein_id|NP_375819.1, gi|15928286, geneID|1125422
2697 2803941 2805821 1881 + -11     1: 8   ABC transporter-like sensor and permease protein SERP0020 gene_name|vraE, locus|SA2493, protein_id|NP_375820.1, gi|15928287, geneID|1125423
2698 2805913 2806104 192 + 91         Uncharacterized protein SAV2703 locus|SAS091, protein_id|NP_375821.1, gi|15928288, geneID|1125424
2699 2806496 2806696 201 + 391     1: 11 dlit(10515936) Cold shock protein of CSP family gene_name|cspB, locus|SA2494, protein_id|NP_375822.1, gi|15928289, geneID|1125425
2700 2807383 2806814 570 - 117         Transcriptional regulator SERP0012, Xre family locus|SA2495, protein_id|NP_375823.1, gi|15928290, geneID|1125426
2701 2808038 2807643 396 - 259         Uncharacterized protein SERP0010 locus|SA2496, protein_id|NP_375824.1, gi|15928291, geneID|1125427
2702 2808459 2808106 354 - 67         Uncharacterized protein SERP0009 locus|SA2497, protein_id|NP_375825.1, gi|15928292, geneID|1125428
2703 2808647 2808796 150 + 187         hypothetical protein locus|SAS092, protein_id|NP_375826.1, gi|15928293, geneID|1125429
2704 2809749 2808910 840 - 113   3: 9 1 10   Chromosome (plasmid) partitioning protein ParB-2 locus|SA2498, protein_id|NP_375827.1, gi|15928294, geneID|1125430
2705 2810511 2809792 720 - 42 22 2: 14 1   16S rRNA (guanine(527)-N(7))-methyltransferase (EC 2.1.1.170) gene_name|gidB, locus|SA2499, protein_id|NP_375828.1, gi|15928295, geneID|1125431
2706 2812388 2810511 1878 - -1 13 1: 3   tRNA-5-carboxymethylaminomethyl-2-thiouridine(34) synthesis protein MnmG gene_name|gidA, locus|SA2500, protein_id|NP_375829.1, gi|15928296, geneID|1125432
2707 2813834 2812455 1380 - 66 10 4: 3 7 2 1   tRNA-5-carboxymethylaminomethyl-2-thiouridine(34) synthesis protein MnmE gene_name|trmE, locus|SA2501, protein_id|NP_375830.1, gi|15928297, geneID|1125433
2708 2814344 2813991 354 - 156     3: 15 2 1 dlit(10623511) Ribonuclease P protein component (EC 3.1.26.5) gene_name|rnpA, locus|SA2502, protein_id|NP_375831.1, gi|15928298, geneID|1125434
2709 2814602 2814465 138 - 120     5: 12 5 4 2 1   LSU ribosomal protein L34p gene_name|rpmH, locus|SAS093, protein_id|NP_375832.1, gi|15928299, geneID|1125435

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Two_cell_division_clusters_relating_to_chromosome_partitioning RossO Chromosome (plasmid) partitioning protein ParB
Cell_Division_Subsystem_including_YidCD RossO Chromosome (plasmid) partitioning protein ParB
Bacterial_Cytoskeleton OlgaZ Chromosome (plasmid) partitioning protein ParB


  Protein Sequence

>fig|158879.11.peg.2704 Chromosome (plasmid) partitioning protein ParB-2
MKKPFSKLFGLKNKDDIIGHIEEDRNSNVESIQIERIVPNRYQPRQVFEPNKIKELAESI
HEHGLLQPIVVRPIEEDMFEIIAGERRFRAIQSLNLPQADVIIRDMDDEETAVVALIENI
QRENLSVVEEAEAYKKLLEIGDTTQSELAKSLGKSQSFIANKLRLLKLAPKVLLRLREGK
ITERHARAVLSLSDSEQEALIEQVIAQKLNVKQTEDRVRQKTGPEKVKAQNLRFAQDVTQ
ARDEVGKSIQAIQQTGLHVEHKDKDHEDYYEIKIRIYKR

MD5 = 9acb6b92aa00c2643ba7b4c4562f62b6


  DNA Sequence

>fig|158879.11.peg.2704 Chromosome (plasmid) partitioning protein ParB-2
atgaaaaaacctttttcaaaattatttggtttgaaaaacaaagatgacatcattggacat
attgaagaagatcgcaatagtaatgttgaatccattcaaattgaacgtatcgttcccaac
cgttatcaaccaagacaggtgtttgaaccaaataaaattaaagaacttgctgaatcaata
catgaacatggtttactacaacctattgttgtaagaccgattgaagaagatatgtttgaa
attattgctggagagcgccgatttagagcaatacaatcactaaatttacctcaagcagac
gttattattcgtgatatggatgatgaagagacggctgttgttgcattaattgagaatatt
caaagagaaaatttgtctgttgttgaagaagcggaagcctataagaaattattggaaatt
ggtgatacaacgcaaagtgaattggcaaaaagtttaggtaaaagtcaaagctttattgca
aataagttgcgtttattgaagttggcgccgaaagtactacttcgcttaagagaaggtaaa
attactgaacgccatgcgagagcggtattatcattgtctgatagtgaacaagaagcgttg
attgagcaagtcattgcacaaaaactaaatgtgaaacagactgaagatagagtacgccaa
aaaacggggcccgaaaaagtcaaagcacaaaaccttcgctttgcacaagatgtcactcaa
gcacgagatgaggtaggcaaaagtatccaagcgattcaacaaacaggactacatgttgag
cataaagacaaagatcatgaagattattatgaaataaaaattcgaatatataaacgttag


  DNA with Flanking Sequence

>fig|158879.11.peg.2704 Chromosome (plasmid) partitioning protein ParB-2
aaataatgtttccgcagttaaaagtgacgattgttgattcattaaataagcgtattcaat
ttttaaaccatttagcgtcagaattacaattacaggatgtcagctttatacacgatagag
cagaaacatttggtaagggtgtctacagggagtcttatgatgttgttactgcaagagcag
tagctagattatccgtgttgagtgaattgtgtttaccgctaattaaaaaaggtggacagt
ttgttgcattaaaatcttcaaaaggtgaagaagaattagaagaagcaaaatttgcaatta
gtgtgttaggtggtaacgttacagaaacacatacctttaaattgccagaagatgctggag
agcgccagatgttcattattgataaaaaaagacagacgccgaaaaagtacccaagaaaac
cagggacgcctaataagactcctttacttgaaaaataatgcataatcctttacaactaac
ataaaaggagcgaatggataatgaaaaaacctttttcaaaattatttggtttgaaaaaca
aagatgacatcattggacatattgaagaagatcgcaatagtaatgttgaatccattcaaa
ttgaacgtatcgttcccaaccgttatcaaccaagacaggtgtttgaaccaaataaaatta
aagaacttgctgaatcaatacatgaacatggtttactacaacctattgttgtaagaccga
ttgaagaagatatgtttgaaattattgctggagagcgccgatttagagcaatacaatcac
taaatttacctcaagcagacgttattattcgtgatatggatgatgaagagacggctgttg
ttgcattaattgagaatattcaaagagaaaatttgtctgttgttgaagaagcggaagcct
ataagaaattattggaaattggtgatacaacgcaaagtgaattggcaaaaagtttaggta
aaagtcaaagctttattgcaaataagttgcgtttattgaagttggcgccgaaagtactac
ttcgcttaagagaaggtaaaattactgaacgccatgcgagagcggtattatcattgtctg
atagtgaacaagaagcgttgattgagcaagtcattgcacaaaaactaaatgtgaaacaga
ctgaagatagagtacgccaaaaaacggggcccgaaaaagtcaaagcacaaaaccttcgct
ttgcacaagatgtcactcaagcacgagatgaggtaggcaaaagtatccaagcgattcaac
aaacaggactacatgttgagcataaagacaaagatcatgaagattattatgaaataaaaa
ttcgaatatataaacgttagtagtaggatgtcgtatacatgatgactaacacataaaaga
caaagctaagatcataacagctttgtctttttttgttttacgtgaaacataaaaatttat
atttatatgttgatcaggctggtacataaatcaatgttctatgctctacgaagttatatt
ggcagtagttgactgaacgaaaatgcgcttgtaacaagcttttttcaattctagtcaacc
ttgctggggtgggacgacgaaataaattttgcgaaaatatcatttctgtcccactcccta
atttgagctggatataccttcatttgaaccctttattgctagtttatgaaagtatcatga
aagctttatgaacatcgcttgagttgcctttacagtagaaaatttaagttttacactttg
tgtgaatgatacgttttgtattgaattaattatagaaaggtacgttgaagatgttttcaa
ttggaagtgcaattcttcattttgtcattggtggtatcgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
cmr|NT01SA2758 Staphylococcus aureus N315     chromosome partioning protein, ParB family
cmr|NT02SA2702 Staphylococcus aureus Mu50     DNA-binding protein Spo0J-like protein
cmr|NT03SA2845 Staphylococcus aureus MW2     chromosome partioning protein, ParB family
cmr|NT05SA2726 Staphylococcus aureus NCTC 8325     protein YyaA
cmr|NT09SA2599 Staphylococcus aureus subsp. aureus MSSA476     spoOJ protein
cmr|SACOL2735 Staphylococcus aureus subsp. aureus COL     chromosome partioning protein, ParB family
cmr|SAUSA300_2643 Staphylococcus aureus subsp. aureus USA300-FPR3757     putative chromosome partioning protein, ParB family
dbj|BAB43806.1 Staphylococcus aureus subsp. aureus N315     SA2498
dbj|BAB58871.1 Staphylococcus aureus subsp. aureus Mu50     DNA-binding protein Spo0j-like protein
dbj|BAB96492.1 Staphylococcus aureus subsp. aureus MW2     MW2627
dbj|BAF68881.1 Staphylococcus aureus subsp. aureus str. Newman     chromosome partioning ParB family protein
dbj|BAF79576.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG44410.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative DNA-binding protein
fig|158878.1.peg.2709 Staphylococcus aureus subsp. aureus Mu50 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|158878.14.peg.2806 Staphylococcus aureus subsp. aureus Mu50 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|158879.1.peg.2588 Staphylococcus aureus subsp. aureus N315 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|196620.1.peg.2627 Staphylococcus aureus subsp. aureus MW2 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|196620.5.peg.2714 Staphylococcus aureus subsp. aureus MW2 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|282459.1.peg.2573 Staphylococcus aureus subsp. aureus MSSA476 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|282459.5.peg.2699 Staphylococcus aureus subsp. aureus MSSA476 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|359786.13.peg.2879 Staphylococcus aureus subsp. aureus JH9 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|359786.3.peg.1988 Staphylococcus aureus subsp. aureus JH9 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|359787.11.peg.2839 Staphylococcus aureus subsp. aureus JH1 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|359787.3.peg.933 Staphylococcus aureus subsp. aureus JH1 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|367830.3.peg.2599 Staphylococcus aureus subsp. aureus USA300 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|418127.4.peg.2488 Staphylococcus aureus subsp. aureus Mu3 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|418127.6.peg.2761 Staphylococcus aureus subsp. aureus Mu3 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|426430.6.peg.2516 Staphylococcus aureus subsp. aureus str. Newman FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|426430.8.peg.2825 Staphylococcus aureus subsp. aureus str. Newman FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|450394.6.peg.1713 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|451515.3.peg.2828 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|451516.9.peg.2822 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|452948.4.peg.909 Staphylococcus aureus 930918-3 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|455227.3.peg.1448 Staphylococcus aureus D30 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|505321.3.peg.2383 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|548474.3.peg.163 Staphylococcus aureus subsp. aureus TCH130 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|548475.3.peg.1458 Staphylococcus aureus subsp. aureus TCH70 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553565.3.peg.1137 Staphylococcus aureus A5937 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553567.3.peg.859 Staphylococcus aureus A5948 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553568.3.peg.1443 Staphylococcus aureus A6224 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553571.3.peg.1243 Staphylococcus aureus A6300 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553573.3.peg.1785 Staphylococcus aureus A8115 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553574.3.peg.1606 Staphylococcus aureus A8117 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553577.3.peg.1959 Staphylococcus aureus A8796 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553580.3.peg.2004 Staphylococcus aureus A8819 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553581.3.peg.1877 Staphylococcus aureus A9299 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553583.3.peg.754 Staphylococcus aureus A9635 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553588.3.peg.1256 Staphylococcus aureus A9719 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553590.4.peg.1884 Staphylococcus aureus A9754 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553592.3.peg.1473 Staphylococcus aureus A9763 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553594.3.peg.681 Staphylococcus aureus A9765 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553596.3.peg.388 Staphylococcus aureus A9781 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|553601.3.peg.1317 Staphylococcus aureus A10102 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|585150.3.peg.111 Staphylococcus aureus subsp. aureus C160 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|585151.3.peg.2709 Staphylococcus aureus subsp. aureus C427 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|585152.3.peg.2707 Staphylococcus aureus subsp. aureus D139 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|585155.3.peg.265 Staphylococcus aureus subsp. aureus H19 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|585891.3.peg.2796 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|644279.4.peg.86 Staphylococcus aureus subsp. aureus 132 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|680649.3.peg.1038 Staphylococcus aureus subsp. aureus MR1 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|681288.4.peg.2747 Staphylococcus aureus subsp. aureus ED98 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|703339.3.peg.2710 Staphylococcus aureus 04-02981 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|762962.3.peg.1796 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|93061.3.peg.2887 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|93061.5.peg.2755 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|93062.19.peg.2659 Staphylococcus aureus subsp. aureus COL FIG   Chromosome (plasmid) partitioning protein ParB-2
fig|93062.4.peg.2313 Staphylococcus aureus subsp. aureus COL FIG   Chromosome (plasmid) partitioning protein ParB-2
gb|AAW37383.1 Staphylococcus aureus subsp. aureus COL     chromosome partioning protein, ParB family
gb|ABD21671.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     putative chromosome partioning protein, ParB family
gb|ABD32032.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ50507.1 Staphylococcus aureus subsp. aureus JH9     Effector of nucleoid occlusion Noc
gb|ABR53610.1 Staphylococcus aureus subsp. aureus JH1     parB-like partition protein
gb|ABX30698.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     possible transcriptional regulator
gb|EES56322.1 Staphylococcus aureus subsp. aureus TCH70     stage 0 DNA-binding protein
gb|EES94603.1 Staphylococcus aureus subsp. aureus USA300_TCH959     stage 0 DNA-binding protein
gb|EES96876.1 Staphylococcus aureus subsp. aureus TCH130     stage 0 DNA-binding protein
gb|EEV25845.1 Staphylococcus aureus A9781     transcriptional regulator
gb|EEV64511.1 Staphylococcus aureus A9763     transcriptional regulator
gb|EEV67540.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV70594.1 Staphylococcus aureus A9635     conserved hypothetical protein
gb|EEV72125.1 Staphylococcus aureus A9299     chromosome partioning ParB family protein
gb|EEV74798.1 Staphylococcus aureus A8115     chromosome partioning ParB family protein
gb|EEV77983.1 Staphylococcus aureus A6300     chromosome partioning protein
gb|EEV80455.1 Staphylococcus aureus A6224     ParB family chromosome partioning protein
gb|EEV83719.1 Staphylococcus aureus A5948     ParB family chromosome partioning protein ParB family
gb|EEV86249.1 Staphylococcus aureus A5937     chromosome partioning ParB family protein
gb|EEW45251.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0849
gb|EEW47031.1 Staphylococcus aureus D30     hypothetical protein SAD30_1391
gi|13702666 Staphylococcus aureus subsp. aureus N315 NCBI   SA2498
gi|14248484 Staphylococcus aureus subsp. aureus Mu50 NCBI   DNA-binding protein Spo0j-like protein
gi|147742209 Staphylococcus aureus subsp. aureus JH9 NCBI   Effector of nucleoid occlusion Noc
gi|148269140 Staphylococcus aureus subsp. aureus JH9 NCBI   parB-like partition protein
gi|149947674 Staphylococcus aureus subsp. aureus JH1 NCBI   parB-like partition protein
gi|150375621 Staphylococcus aureus subsp. aureus str. Newman NCBI   chromosome partioning ParB family protein
gi|150395222 Staphylococcus aureus subsp. aureus JH1 NCBI   parB-like partition protein
gi|151222821 Staphylococcus aureus subsp. aureus str. Newman NCBI   chromosome partioning ParB family protein
gi|156723159 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156981024 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2693
gi|15925699 Staphylococcus aureus subsp. aureus Mu50 NCBI   DNA-binding protein Spo0j-like protein
gi|15928294 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2498
gi|160369727 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   possible transcriptional regulator
gi|161510918 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   transcriptional regulator
gi|21205800 Staphylococcus aureus subsp. aureus MW2 NCBI   MW2627
gi|21284356 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW2627
gi|251803665 Staphylococcus aureus subsp. aureus TCH70 NCBI   stage 0 DNA-binding protein
gi|251812832 Staphylococcus aureus subsp. aureus TCH70 NCBI   stage 0 DNA-binding protein
gi|253316835 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   ParB family chromosome partioning protein ParB family
gi|253725874 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   stage 0 DNA-binding protein
gi|253728147 Staphylococcus aureus subsp. aureus TCH130 NCBI   stage 0 DNA-binding protein
gi|253730394 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   stage 0 DNA-binding protein
gi|253733844 Staphylococcus aureus subsp. aureus TCH130 NCBI   stage 0 DNA-binding protein
gi|255007480 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   ParB family chromosome partioning protein ParB family
gi|257787505 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257793533 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257840046 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|257843125 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257846572 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|257848133 Staphylococcus aureus A9299 NCBI   chromosome partioning ParB family protein
gi|257850854 Staphylococcus aureus A8115 NCBI   chromosome partioning ParB family protein
gi|257855040 Staphylococcus aureus A6300 NCBI   chromosome partioning protein
gi|257857560 Staphylococcus aureus A6224 NCBI   ParB family chromosome partioning protein
gi|257860902 Staphylococcus aureus A5948 NCBI   ParB family chromosome partioning protein ParB family
gi|257863489 Staphylococcus aureus A5937 NCBI   chromosome partioning ParB family protein
gi|258411161 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|258420935 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258423243 Staphylococcus aureus A9635 NCBI   conserved hypothetical protein
gi|258438574 Staphylococcus aureus A9299 NCBI   chromosome partioning ParB family protein
gi|258443970 Staphylococcus aureus A8115 NCBI   chromosome partioning ParB family protein
gi|258446214 Staphylococcus aureus A6300 NCBI   chromosome partioning protein
gi|258449127 Staphylococcus aureus A6224 NCBI   ParB family chromosome partioning protein
gi|258451372 Staphylococcus aureus A5948 NCBI   ParB family chromosome partioning protein ParB family
gi|258454395 Staphylococcus aureus A5937 NCBI   chromosome partioning ParB family protein
gi|259160222 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0849
gi|259162461 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1391
gi|49245929 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative DNA-binding protein
gi|49487486 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative DNA-binding protein
gi|57285289 Staphylococcus aureus subsp. aureus COL NCBI   chromosome partioning protein, ParB family
gi|57651103 Staphylococcus aureus subsp. aureus COL NCBI   ParB family chromosome partioning protein
gi|87127157 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   putative chromosome partioning protein, ParB family
gi|87161183 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   ParB family chromosome partioning protein ParB family
gi|87204222 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196664 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_03049
img|637094256 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637101266 Staphylococcus aureus aureus Mu50 IMG   DNA-binding protein Spo0j-like protein
img|637153474 Staphylococcus aureus aureus COL IMG   chromosome partioning protein, ParB family
img|637158864 Staphylococcus aureus aureus MSSA476 IMG   putative DNA-binding protein
img|637300444 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637889285 Staphylococcus aureus aureus USA300 IMG   putative chromosome partioning protein, ParB family
img|637895644 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639107600 Staphylococcus aureus aureus JH1 IMG   ParB-like partition protein
img|640567115 Staphylococcus aureus aureus JH9 IMG   parB-like partition protein
img|640780897 Staphylococcus aureus aureus JH1 IMG   parB-like partition protein
img|640797040 Staphylococcus aureus aureus Newman IMG   chromosome partioning ParB family protein
img|640905491 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641310712 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   possible transcriptional regulator
kegg|saa:SAUSA300_2643 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   ParB family chromosome partioning protein ParB family
kegg|sac:SACOL2735 Staphylococcus aureus subsp. aureus COL KEGG   ParB family chromosome partioning protein
kegg|sae:NWMN_2609 Staphylococcus aureus subsp. aureus Newman KEGG   chromosome partioning ParB family protein
kegg|sah:SaurJH1_2788 Staphylococcus aureus subsp. aureus JH1 KEGG   ParB-like partition protein
kegg|saj:SaurJH9_2731 Staphylococcus aureus subsp. aureus JH9 KEGG   ParB-like partition protein
kegg|sam:MW2627 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_03049 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sas:SAS2591   KEGG   putative DNA-binding protein
kegg|sau:SA2498   KEGG   hypothetical protein
kegg|sav:SAV2709   KEGG   DNA-binding protein Spo0J-like protein
kegg|saw:SAHV_2693 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_2712 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   transcriptional regulator
ref|NP_373233.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   DNA-binding protein Spo0j-like protein
ref|NP_375827.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2498
ref|NP_647444.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW2627
ref|YP_001248083.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   parB-like partition protein
ref|YP_001317897.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   parB-like partition protein
ref|YP_001333643.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   chromosome partioning ParB family protein
ref|YP_001443283.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2693
ref|YP_001576577.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   transcriptional regulator
ref|YP_044707.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative DNA-binding protein
ref|YP_187521.1 Staphylococcus aureus subsp. aureus COL RefSeq   ParB family chromosome partioning protein
ref|YP_495277.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   ParB family chromosome partioning protein ParB family
ref|YP_501495.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_03049
ref|ZP_04827305.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   stage 0 DNA-binding protein
ref|ZP_04840048.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   ParB family chromosome partioning protein ParB family
ref|ZP_04864559.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   stage 0 DNA-binding protein
ref|ZP_04868009.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   stage 0 DNA-binding protein
ref|ZP_05146081.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   ParB family chromosome partioning protein ParB family
ref|ZP_05642512.1 Staphylococcus aureus A9781 RefSeq   transcriptional regulator
ref|ZP_05681440.1 Staphylococcus aureus A9763 RefSeq   transcriptional regulator
ref|ZP_05683869.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05686135.1 Staphylococcus aureus A9635 RefSeq   conserved hypothetical protein
ref|ZP_05689797.1 Staphylococcus aureus A9299 RefSeq   chromosome partioning ParB family protein
ref|ZP_05692308.1 Staphylococcus aureus A8115 RefSeq   chromosome partioning ParB family protein
ref|ZP_05694374.1 Staphylococcus aureus A6300 RefSeq   chromosome partioning protein
ref|ZP_05697233.1 Staphylococcus aureus A6224 RefSeq   ParB family chromosome partioning protein
ref|ZP_05699403.1 Staphylococcus aureus A5948 RefSeq   ParB family chromosome partioning protein ParB family
ref|ZP_05702363.1 Staphylococcus aureus A5937 RefSeq   chromosome partioning ParB family protein
tr|A5IWD4 Staphylococcus aureus (strain JH9) TrEMBL   Effector of nucleoid occlusion Noc
tr|A6QKJ9 Staphylococcus aureus (strain Newman) TrEMBL   Chromosome partioning ParB family protein
tr|A6U592 Staphylococcus aureus (strain JH1) TrEMBL   ParB-like partition protein
tr|A7X7A4 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8YYR8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Possible transcriptional regulator
tr|C5N0R7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Stage 0 DNA-binding protein
tr|C5Q1J0 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Stage 0 DNA-binding protein
tr|C5QET9 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Stage 0 DNA-binding protein
tr|Q2FDF1 Staphylococcus aureus (strain USA300) TrEMBL   Putative chromosome partioning protein, ParB family
tr|Q2FUQ5 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HCI6 Staphylococcus aureus (strain COL) TrEMBL   Chromosome partioning protein, ParB family
tr|Q6G5W7 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative DNA-binding protein
tr|Q79ZU5 Staphylococcus aureus (strain MW2) TrEMBL   MW2627 protein
tr|Q7A321 Staphylococcus aureus (strain N315) TrEMBL   SA2498 protein
tr|Q99QT6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   DNA-binding protein Spo0j-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
22 fig|158879.11.peg.2705 16S rRNA (guanine(527)-N(7))-methyltransferase (EC 2.1.1.170)
13 fig|158879.11.peg.2706 tRNA-5-carboxymethylaminomethyl-2-thiouridine(34) synthesis protein MnmG
10 fig|158879.11.peg.2707 tRNA-5-carboxymethylaminomethyl-2-thiouridine(34) synthesis protein MnmE


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search