The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2688: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Transcriptional regulator, PadR family
Translate Function Assignments



Context on contig NC_002745 from base 2789575 to 2801227 (11653 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2682 2790423 2789575 849 -       2: 7 2   protein of unknown function DUF62 locus|SA2478, protein_id|NP_375805.1, gi|15928272, geneID|1125408
2683 2790802 2791317 516 + 378         Polyisoprenoid-binding periplasmic protein YceI locus|SA2479, protein_id|NP_375806.1, gi|15928273, geneID|1125409
2684 2792442 2791468 975 - 150       dlit(16019162)
dlit(17166853)
Lactonase Drp35 gene_name|drp35, locus|SA2480, protein_id|NP_375807.1, gi|15928274, geneID|1125410
2685 2792683 2793639 957 + 240     1: 5   tRNA 5-hydroxyuridine(34) synthetase TrhO locus|SA2481, protein_id|NP_375808.1, gi|15928275, geneID|1125411
2686 2793791 2794429 639 + 151     1: 6 dlit(8529900) Pyrrolidone-carboxylate peptidase (EC 3.4.19.3) gene_name|pcp, locus|SA2482, protein_id|NP_375809.1, gi|15928276, geneID|1125412
2687 2795315 2794548 768 - 118         FIG01108365: hypothetical protein locus|SA2483, protein_id|NP_375810.1, gi|15928277, geneID|1125413
2688 2795643 2795305 339 - -11     1: 3   Transcriptional regulator, PadR family locus|SA2484, protein_id|NP_375811.1, gi|15928278, geneID|1125414
2689 2795810 2796274 465 + 166         FIG01107962: hypothetical protein locus|SA2485, protein_id|NP_375812.1, gi|15928279, geneID|1125415
2690 2796512 2797930 1419 + 237         2-oxoglutarate/malate translocator locus|SA2486, protein_id|NP_375813.1, gi|15928280, geneID|1125416
2691 2799252 2798344 909 - 413         Uncharacterized inner membrane protein RarD locus|SA2487, protein_id|NP_375814.1, gi|15928281, geneID|1125417
2692 2799474 2800049 576 + 221         FIG01108047: hypothetical protein locus|SA2488, protein_id|NP_375815.1, gi|15928282, geneID|1125418
2693 2800175 2801227 1053 + 125     2: 1 4   HoxN/HupN/NixA family nickel/cobalt transporter locus|SA2489, protein_id|NP_375816.1, gi|15928283, geneID|1125419

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
CBSS-1352.1.peg.856 DanielaB Transcriptional regulator, PadR family


  Protein Sequence

>fig|158879.11.peg.2688 Transcriptional regulator, PadR family
MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYV
DTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN

MD5 = 3e59ca9347f6441e2380da71f93d212f


  DNA Sequence

>fig|158879.11.peg.2688 Transcriptional regulator, PadR family
atgtcagtgtcagatcagattatgaaaggtctcttagatggggcgatattaggtctcatt
gcccaaggcgaaacgtatggatatgaaattatgacgaaacttaagaatcaagagtttcca
gagataagtgagggtagtatttatccagttttaatgcgtttaaacaaaaaaggatacgtt
gatacgacaataaaaaaatctagtaatggcggcccgaggcggaaatactatacgattacc
gattcaggtttaaaggaactaaaagtatttaaatcaaaatggcaagctttgaataaaggg
atgattaacttgtttggaggggaaaacgatgttaactaa


  DNA with Flanking Sequence

>fig|158879.11.peg.2688 Transcriptional regulator, PadR family
ctaaatcatcttcagttagatttcgtgcacgttcaggtaatgtttggagaccttctaaaa
tcttttcaatactcggtacttcatccttccattcatctggagacgaaccatttccgaata
aaggtctatagatatttaaatcaatattctctttaccagcaacagctaaggccgattcaa
aaattgttaatacatgcccaaattgccaatgaatggtattagaaaaaggctcatgataat
catcaagtaccttttcaactttccaagcatcatacacatttactaaatatcctaacccca
tatcaatgacatcaaatactgtttttgtagtcattattaattcctcccccataaataaaa
catacttccgtaagtattaccctattaacaaagttgttagtcatttaaggaatgtgtaca
acaactaccttacaataaaagatagttgacgaaaagttctcaatgtactatcttattatg
taagatagtaggtgattaaaatgtcagtgtcagatcagattatgaaaggtctcttagatg
gggcgatattaggtctcattgcccaaggcgaaacgtatggatatgaaattatgacgaaac
ttaagaatcaagagtttccagagataagtgagggtagtatttatccagttttaatgcgtt
taaacaaaaaaggatacgttgatacgacaataaaaaaatctagtaatggcggcccgaggc
ggaaatactatacgattaccgattcaggtttaaaggaactaaaagtatttaaatcaaaat
ggcaagctttgaataaagggatgattaacttgtttggaggggaaaacgatgttaactaaa
caatctcaagattttttagaaaaattacgtgttgaattgttatttagaggtaagactgaa
gcagaagtagaagagttattggaagagctcgaagatcatttaactatggctgaaaaaaat
aacgaagatacaagttcaattattaatacaccgattaagtcaatggctgatcaattatca
cctgagataagtcttactaccggtttgtataaatatattactttgtacttctcttttata
ttagcagtcattataattcctaggtttttagatttgggtacatttgatgtgacaattgca
tttttactttatatagctagtatcgttattttaggtgttgtcattggtatgctgattcta
cgcaatacattagtccgatttggtgaccaaaaaataacgtatgttataaatgtgacttat
ggaattgtcgtatttttatggatgatttttggtggtttgattattaaaaaatatcctatc
tatagtttctttgagttaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA2742 Staphylococcus aureus N315     transcriptional regulator, PadR family domain protein
cmr|NT02SA2686 Staphylococcus aureus Mu50     Transcriptional regulator, PadR family
dbj|BAB43790.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB58854.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF79559.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.2692 Staphylococcus aureus subsp. aureus Mu50 FIG   Transcriptional regulator, PadR family
fig|158878.14.peg.2789 Staphylococcus aureus subsp. aureus Mu50 FIG   Transcriptional regulator, PadR family
fig|158879.1.peg.2572 Staphylococcus aureus subsp. aureus N315 FIG   Transcriptional regulator, PadR family
fig|359786.13.peg.2863 Staphylococcus aureus subsp. aureus JH9 FIG   Transcriptional regulator, PadR family
fig|359786.3.peg.1973 Staphylococcus aureus subsp. aureus JH9 FIG   Transcriptional regulator, PadR family
fig|359787.3.peg.918 Staphylococcus aureus subsp. aureus JH1 FIG   Transcriptional regulator, PadR family
fig|505321.3.peg.2240 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Transcriptional regulator, PadR family
fig|553565.3.peg.1121 Staphylococcus aureus A5937 FIG   Transcriptional regulator, PadR family
fig|553568.3.peg.1459 Staphylococcus aureus A6224 FIG   Transcriptional regulator, PadR family
fig|553571.3.peg.1227 Staphylococcus aureus A6300 FIG   Transcriptional regulator, PadR family
fig|553573.3.peg.1801 Staphylococcus aureus A8115 FIG   Transcriptional regulator, PadR family
fig|553577.3.peg.1943 Staphylococcus aureus A8796 FIG   Transcriptional regulator, PadR family
fig|553580.3.peg.1988 Staphylococcus aureus A8819 FIG   Transcriptional regulator, PadR family
fig|553581.3.peg.1861 Staphylococcus aureus A9299 FIG   Transcriptional regulator, PadR family
fig|553588.3.peg.1240 Staphylococcus aureus A9719 FIG   Transcriptional regulator, PadR family
fig|553592.3.peg.1489 Staphylococcus aureus A9763 FIG   Transcriptional regulator, PadR family
fig|553601.3.peg.1301 Staphylococcus aureus A10102 FIG   Transcriptional regulator, PadR family
fig|585891.3.peg.2779 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Transcriptional regulator, PadR family
fig|680649.3.peg.872 Staphylococcus aureus subsp. aureus MR1 FIG   Transcriptional regulator, PadR family
fig|681288.4.peg.2731 Staphylococcus aureus subsp. aureus ED98 FIG   Transcriptional regulator, PadR family
fig|703339.3.peg.2694 Staphylococcus aureus 04-02981 FIG   Transcriptional regulator, PadR family
gb|ABQ50492.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, PadR family
gb|ABR53595.1 Staphylococcus aureus subsp. aureus JH1     transcriptional regulator PadR family protein
gb|EEV25830.1 Staphylococcus aureus A9781     transcriptional regulator
gb|EEV64526.1 Staphylococcus aureus A9763     transcriptional regulator
gb|EEV67524.1 Staphylococcus aureus A9719     transcriptional regulator PadR family protein
gb|EEV72110.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74813.1 Staphylococcus aureus A8115     transcriptional regulator PadR family protein
gb|EEV77967.1 Staphylococcus aureus A6300     PadR family transcriptional regulator
gb|EEV80471.1 Staphylococcus aureus A6224     transcriptional regulator
gb|EEV86233.1 Staphylococcus aureus A5937     transcriptional regulator PadR family protein
gi|13702650 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14248467 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147742194 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, PadR family
gi|148269125 Staphylococcus aureus subsp. aureus JH9 NCBI   PadR-like family transcriptional regulator
gi|149947659 Staphylococcus aureus subsp. aureus JH1 NCBI   transcriptional regulator PadR family protein
gi|150395207 Staphylococcus aureus subsp. aureus JH1 NCBI   transcriptional regulator PadR family protein
gi|156723142 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156981007 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2676
gi|15925682 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2692
gi|15928278 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2484
gi|253316695 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_11210
gi|255007464 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_13365
gi|257787490 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257793518 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257840061 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|257843109 Staphylococcus aureus A9719 NCBI   transcriptional regulator PadR family protein
gi|257848118 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850869 Staphylococcus aureus A8115 NCBI   transcriptional regulator PadR family protein
gi|257855024 Staphylococcus aureus A6300 NCBI   PadR family transcriptional regulator
gi|257857576 Staphylococcus aureus A6224 NCBI   transcriptional regulator
gi|257863473 Staphylococcus aureus A5937 NCBI   transcriptional regulator PadR family protein
gi|258411176 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|258420919 Staphylococcus aureus A9719 NCBI   transcriptional regulator PadR family protein
gi|258438559 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258443985 Staphylococcus aureus A8115 NCBI   transcriptional regulator PadR family protein
gi|258446198 Staphylococcus aureus A6300 NCBI   PadR family transcriptional regulator
gi|258449143 Staphylococcus aureus A6224 NCBI   transcriptional regulator
gi|258454379 Staphylococcus aureus A5937 NCBI   transcriptional regulator PadR family protein
img|637094240 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637101249 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|639107585 Staphylococcus aureus aureus JH1 IMG   Transcriptional regulator PadR-like
img|640567100 Staphylococcus aureus aureus JH9 IMG   transcriptional regulator, PadR-like family
img|640780882 Staphylococcus aureus aureus JH1 IMG   transcriptional regulator PadR family protein
img|640905474 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_2773 Staphylococcus aureus subsp. aureus JH1 KEGG   transcriptional regulator PadR family protein
kegg|saj:SaurJH9_2716 Staphylococcus aureus subsp. aureus JH9 KEGG   PadR-like family transcriptional regulator
kegg|sau:SA2484   KEGG   hypothetical protein
kegg|sav:SAV2692   KEGG   hypothetical protein
kegg|saw:SAHV_2676 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_373216.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2692
ref|NP_375811.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2484
ref|YP_001248068.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   PadR-like family transcriptional regulator
ref|YP_001317882.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   transcriptional regulator PadR family protein
ref|YP_001443266.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2676
ref|ZP_04839908.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_11210
ref|ZP_05146065.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_13365
ref|ZP_05642497.1 Staphylococcus aureus A9781 RefSeq   transcriptional regulator
ref|ZP_05681455.1 Staphylococcus aureus A9763 RefSeq   transcriptional regulator
ref|ZP_05683853.1 Staphylococcus aureus A9719 RefSeq   transcriptional regulator PadR family protein
ref|ZP_05689782.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692323.1 Staphylococcus aureus A8115 RefSeq   transcriptional regulator PadR family protein
ref|ZP_05694358.1 Staphylococcus aureus A6300 RefSeq   PadR family transcriptional regulator
ref|ZP_05697249.1 Staphylococcus aureus A6224 RefSeq   transcriptional regulator
ref|ZP_05702347.1 Staphylococcus aureus A5937 RefSeq   transcriptional regulator PadR family protein
tr|A5IWB9 Staphylococcus aureus (strain JH9) TrEMBL   Transcriptional regulator, PadR family
tr|A6U577 Staphylococcus aureus (strain JH1) TrEMBL   Transcriptional regulator PadR family protein
tr|A7X784 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A336 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA2484
tr|Q99QU9 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search