The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2584: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Mobile element protein
Translate Function Assignments



Context on contig NC_002745 from base 2665753 to 2677683 (11931 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2578 2666475 2665753 723 -       7: 10 5 7 3 6 8 4 dlit(28128549) Epoxyqueuosine reductase (EC 1.17.99.6) QueH locus|SA2377, protein_id|NP_375703.1, gi|15928170, geneID|1125306
2579 2666829 2667278 450 + 353         PhnB-like protein SAV2592 locus|SA2378, protein_id|NP_375704.1, gi|15928171, geneID|1125307
2580 2667946 2667359 588 - 80     1: 2   Transcriptional regulator, AcrR family locus|SA2379, protein_id|NP_375705.1, gi|15928172, geneID|1125308
2581 2668089 2669771 1683 + 142         Predicted acyl esterase/dipeptidyl-peptidase locus|SA2380, protein_id|NP_375706.1, gi|15928173, geneID|1125309
2582 2670504 2669869 636 - 97     1: 1   Predicted cell-wall-anchored protein SasK (LPXTG motif) locus|SA2381, protein_id|NP_375707.1, gi|15928174, geneID|1125310
2583 2670915 2670520 396 - 15         glutamyl endopeptidase precursor locus|SA2382, protein_id|NP_375708.1, gi|15928175, geneID|1125311
2584 2672001 2671339 663 - 423         Mobile element protein locus|SA2383, protein_id|NP_375709.1, gi|15928176, geneID|1125312
2585 2672535 2673266 732 + 533       dlit(3004956)
dlit(2985541)
dlit(10348769)
dlit(11909834)
23S rRNA (adenine(2058)-N(6))-dimethyltransferase (EC 2.1.1.184) => Erm(A) gene_name|ermA, locus|SA2384, protein_id|NP_375710.1, gi|15928177, geneID|1125313
2586 2674174 2673392 783 - 125     1: 9 dlit(10348769)
dlit(3004956)
dlit(2993813)
Aminoglycoside 9-nucleotidyltransferase => ANT(9)-I gene_name|ant(9), locus|SA2385, protein_id|NP_375711.1, gi|15928178, geneID|1125314
2587 2674702 2674325 378 - 150       dlit(10348769)
dlit(3004956)
Mobile element protein gene_name|tnpC, locus|SA2386, protein_id|NP_375712.1, gi|15928179, geneID|1125315
2588 2676601 2674709 1893 - 6       dlit(10348769)
dlit(3004956)
Transposase B from transposon Tn554 gene_name|tnpB, locus|SA2387, protein_id|NP_375713.1, gi|15928180, geneID|1125316
2589 2677683 2676598 1086 - -4       dlit(10348769)
dlit(3004956)
Transposase A from transposon Tn554 gene_name|tnpA, locus|SA2388, protein_id|NP_375714.1, gi|15928181, geneID|1125317

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.2584 Mobile element protein
MNTIESQFDKVAEDYDFVNELLNDYSFFVSNMSPKKGRALDIGCGSGLLVEKLASYYDEV
VGIDISNQMLDLAKSKRQLTNTVYLNMNAEQLNFNEKFDFIVSRTTFHHLDDIASVIQQM
KELLNEEGRIVILDNVSEVETPPTYVYKLGAIQEFLPHCFKFGIKNAIRIYNHNTSKSWL
EHLASDKYLSEQNYYDLYEKLLPGCQFHKMGWAMGVVWTK

MD5 = 75550d614ebad6e32630f78b7bc569bc


  DNA Sequence

>fig|158879.11.peg.2584 Mobile element protein
ttgaatacaatagaatcacagtttgataaggttgcagaagattacgatttcgtgaatgag
cttttgaatgattattcattctttgtgtctaatatgtctccaaagaaaggcagagcatta
gatatcggatgtggctcgggtttgttagtggagaaattagcaagttattatgatgaagtg
gtagggattgatatttctaatcaaatgctcgatcttgccaaatctaaacgtcaactaaca
aatacggtctatctgaatatgaatgcagaacaacttaattttaatgagaagtttgatttt
attgtaagccgaacaacctttcatcatttggatgatatagccagcgtaatacagcaaatg
aaggaactgttgaatgaggaaggaagaatagttattcttgataatgtatctgaagtcgag
acaccgcctacctatgtttataaattaggggcaatccaagagtttttaccgcattgtttc
aaatttggaataaaaaatgcgattagaatttataatcacaacacatctaaatcatggctt
gagcatttagcttcagataagtacctatctgaacaaaattattacgatttatatgaaaag
ttgttgcctggatgccaattccataaaatgggttgggcaatgggggttgtctggacaaaa
taa


  DNA with Flanking Sequence

>fig|158879.11.peg.2584 Mobile element protein
tctccttactggttataatgaactgacattaagcgttcattataaccaattaattttgat
ttggttgataacgaactttattaataacaaatatagaaaaagtacccatacttttatctc
ctttccatttttttcattatgaatgagataaagtaatttctactactgcgatactggtgc
acataattgaaacctccttatgtaactgaatatgattgtatcatcttttcattttagaat
aaacctttatatgtaattttgcacttgacacttcagatggacgttttcttcaaaataata
tgttttgaaacttgataagagaagccactgtctttactaaaaagtaaaggctgcgataaa
ggacagtgactttaataaagttgcactgttgtattgtctttggataaaattgtctaaagg
gaagttttatccccaacgaaaaaacatctaaagtggtaagtaatgaaagaatgtcgataa
agtaggaatgggggatctttttgaatacaatagaatcacagtttgataaggttgcagaag
attacgatttcgtgaatgagcttttgaatgattattcattctttgtgtctaatatgtctc
caaagaaaggcagagcattagatatcggatgtggctcgggtttgttagtggagaaattag
caagttattatgatgaagtggtagggattgatatttctaatcaaatgctcgatcttgcca
aatctaaacgtcaactaacaaatacggtctatctgaatatgaatgcagaacaacttaatt
ttaatgagaagtttgattttattgtaagccgaacaacctttcatcatttggatgatatag
ccagcgtaatacagcaaatgaaggaactgttgaatgaggaaggaagaatagttattcttg
ataatgtatctgaagtcgagacaccgcctacctatgtttataaattaggggcaatccaag
agtttttaccgcattgtttcaaatttggaataaaaaatgcgattagaatttataatcaca
acacatctaaatcatggcttgagcatttagcttcagataagtacctatctgaacaaaatt
attacgatttatatgaaaagttgttgcctggatgccaattccataaaatgggttgggcaa
tgggggttgtctggacaaaataacttaaagctgtggctttgaaaagttgaatttgtgatt
gttttcagagctatcgggtgctttagtataaataacaatgaataaaaaatcagcctgtat
cttatgttactattaagtaatttaagatacaggttttactatttttgaaataagtacctt
ccacttcaaatacatgtattcaaagtgaaagtattgatttaaatgattcttttgtaattt
actcttgataataaaatgctcctacaaaagaagatatagcaattattaagttaaatagta
atttaggaaataaaacaggttacttaactttgaacacacacattagcaaaggtgaaaata
ttgaaatttctggatttccaggagacaagtcagacaacagacaatataaaggtaaaggga
aattagaaagttttgatgagaatgaaatgtattatacggtagacacattttcaggacaaa
gtggtagtgcgataagagattcaaaaaacaatatcatcggagt


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008168       F:methyltransferase activity
cmr|SERP1218 Staphylococcus epidermidis RP62A     Tn554, hypothetical protein
cmr|SERP1341 Staphylococcus epidermidis RP62A     Tn554, hypothetical protein
cmr|SERP2512 Staphylococcus epidermidis RP62A     Tn554, hypothetical protein
dbj|BAB42004.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein within Tn554
dbj|BAB42745.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB43234.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB43688.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB57815.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAC57475.1 Staphylococcus aureus     hypothetical protein
dbj|BAE06291.1 Staphylococcus aureus     hypothetical protein
dbj|BAF78523.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
dbj|BAH66411.1 Staphylococcus aureus     transposon Tn554 hypothetical protein
emb|CAA26967.1 Staphylococcus aureus EMBL   unnamed protein product
emb|CAG39077.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   hypothetical protein
emb|CAG40726.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   transposon Tn554 hypothetical protein
fig|158878.1.peg.1653 Staphylococcus aureus subsp. aureus Mu50 FIG   Mobile element protein
fig|158878.14.peg.1708 Staphylococcus aureus subsp. aureus Mu50 FIG   Mobile element protein
fig|158878.14.peg.47 Staphylococcus aureus subsp. aureus Mu50 FIG   Mobile element protein
fig|158879.1.peg.1528 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.1.peg.2017 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.1.peg.2470 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.1.peg.787 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.11.peg.1597 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.11.peg.2106 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.11.peg.47 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|158879.11.peg.815 Staphylococcus aureus subsp. aureus N315 FIG   Mobile element protein
fig|176279.3.peg.1191 Staphylococcus epidermidis RP62A FIG   Mobile element protein
fig|176279.3.peg.2444 Staphylococcus epidermidis RP62A FIG   Mobile element protein
fig|176279.3.peg.875 Staphylococcus epidermidis RP62A FIG   Mobile element protein
fig|176279.9.peg.1186 Staphylococcus epidermidis RP62A FIG   Mobile element protein
fig|176279.9.peg.1308 Staphylococcus epidermidis RP62A FIG   Mobile element protein
fig|176279.9.peg.2432 Staphylococcus epidermidis RP62A FIG   Mobile element protein
fig|282458.1.peg.1640 Staphylococcus aureus subsp. aureus MRSA252 FIG   Mobile element protein
fig|282458.1.peg.44 Staphylococcus aureus subsp. aureus MRSA252 FIG   Mobile element protein
fig|282458.4.peg.1737 Staphylococcus aureus subsp. aureus MRSA252 FIG   Mobile element protein
fig|282458.4.peg.47 Staphylococcus aureus subsp. aureus MRSA252 FIG   Mobile element protein
fig|359786.13.peg.1812 Staphylococcus aureus subsp. aureus JH9 FIG   Mobile element protein
fig|359786.13.peg.73 Staphylococcus aureus subsp. aureus JH9 FIG   Mobile element protein
fig|359786.3.peg.2031 Staphylococcus aureus subsp. aureus JH9 FIG   Mobile element protein
fig|359786.3.peg.2595 Staphylococcus aureus subsp. aureus JH9 FIG   Mobile element protein
fig|359787.11.peg.1789 Staphylococcus aureus subsp. aureus JH1 FIG   Mobile element protein
fig|359787.11.peg.71 Staphylococcus aureus subsp. aureus JH1 FIG   Mobile element protein
fig|359787.3.peg.1004 Staphylococcus aureus subsp. aureus JH1 FIG   Mobile element protein
fig|418127.4.peg.1524 Staphylococcus aureus subsp. aureus Mu3 FIG   Mobile element protein
fig|418127.4.peg.42 Staphylococcus aureus subsp. aureus Mu3 FIG   Mobile element protein
fig|418127.6.peg.1686 Staphylococcus aureus subsp. aureus Mu3 FIG   Mobile element protein
fig|418127.6.peg.46 Staphylococcus aureus subsp. aureus Mu3 FIG   Mobile element protein
fig|452948.4.peg.2639 Staphylococcus aureus 930918-3 FIG   Mobile element protein
fig|546340.3.peg.957 Enterococcus faecium E1679 FIG   Mobile element protein
fig|546342.3.peg.958 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Mobile element protein
fig|546343.3.peg.96 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Mobile element protein
fig|553565.3.peg.1298 Staphylococcus aureus A5937 FIG   Mobile element protein
fig|553567.3.peg.1413 Staphylococcus aureus A5948 FIG   Mobile element protein
fig|553568.3.peg.639 Staphylococcus aureus A6224 FIG   Mobile element protein
fig|553571.3.peg.2384 Staphylococcus aureus A6300 FIG   Mobile element protein
fig|553577.3.peg.2796 Staphylococcus aureus A8796 FIG   Mobile element protein
fig|553580.3.peg.2854 Staphylococcus aureus A8819 FIG   Mobile element protein
fig|553588.3.peg.2811 Staphylococcus aureus A9719 FIG   Mobile element protein
fig|553592.3.peg.647 Staphylococcus aureus A9763 FIG   Mobile element protein
fig|553596.3.peg.599 Staphylococcus aureus A9781 FIG   Mobile element protein
fig|553601.3.peg.2743 Staphylococcus aureus A10102 FIG   Mobile element protein
fig|585144.3.peg.2217 Staphylococcus aureus subsp. aureus 58-424 FIG   Mobile element protein
fig|585145.3.peg.1918 Staphylococcus aureus subsp. aureus 65-1322 FIG   Mobile element protein
fig|585146.3.peg.2726 Staphylococcus aureus subsp. aureus 68-397 FIG   Mobile element protein
fig|585154.3.peg.2846 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Mobile element protein
fig|585891.3.peg.1705 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Mobile element protein
fig|585891.3.peg.47 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Mobile element protein
fig|703339.3.peg.1645 Staphylococcus aureus 04-02981 FIG   Mobile element protein
fig|703339.3.peg.48 Staphylococcus aureus 04-02981 FIG   Mobile element protein
gb|AAW53298.1 Staphylococcus epidermidis RP62A     hypothetical protein SERP2512
gb|AAW54554.1 Staphylococcus epidermidis RP62A     Tn554, hypothetical protein
gb|AAW54693.1 Staphylococcus epidermidis RP62A     Tn554, hypothetical protein
gb|ABQ47850.1 Staphylococcus aureus subsp. aureus JH9     Methyltransferase type 12
gb|ABQ49502.1 Staphylococcus aureus subsp. aureus JH9     Methyltransferase type 12
gb|ABR50904.1 Staphylococcus aureus subsp. aureus JH1     Methyltransferase type 12
gb|ABR52590.1 Staphylococcus aureus subsp. aureus JH1     Methyltransferase type 12
gb|EEV06765.1 Staphylococcus aureus subsp. aureus 65-1322     conserved hypothetical protein
gb|EEV08344.1 Staphylococcus aureus subsp. aureus 68-397     conserved hypothetical protein
gb|EEV26044.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65336.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV65975.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV76825.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81290.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83233.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV86045.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|13700707 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein within Tn554
gi|13701451 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|13701942 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|13702547 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14247425 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147739552 Staphylococcus aureus subsp. aureus JH9 NCBI   Methyltransferase type 12
gi|147741204 Staphylococcus aureus subsp. aureus JH9 NCBI   Methyltransferase type 12
gi|148266483 Staphylococcus aureus subsp. aureus JH9 NCBI   methyltransferase type 12
gi|148268135 Staphylococcus aureus subsp. aureus JH9 NCBI   methyltransferase type 12
gi|149944968 Staphylococcus aureus subsp. aureus JH1 NCBI   Methyltransferase type 12
gi|149946654 Staphylococcus aureus subsp. aureus JH1 NCBI   Methyltransferase type 12
gi|150392516 Staphylococcus aureus subsp. aureus JH1 NCBI   methyltransferase type 12
gi|150394202 Staphylococcus aureus subsp. aureus JH1 NCBI   methyltransferase type 12
gi|156722106 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979971 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1640
gi|15924643 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1653
gi|15926493 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0767
gi|15927233 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1479
gi|15927722 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1950
gi|15928176 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2383
gi|221137968 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_04848
gi|221140092 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_00480
gi|238773848 Staphylococcus aureus NCBI   transposon Tn554 hypothetical protein
gi|254663979 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00235
gi|255006440 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_08225
gi|257275278 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257277660 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257428437 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257431606 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257787704 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257793732 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840883 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257841537 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257853868 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858412 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860402 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257863283 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258407520 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258422471 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258447342 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448317 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451919 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258454556 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|28465857 Staphylococcus aureus NCBI   hypothetical protein
gi|49240426 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein
gi|49242027 Staphylococcus aureus subsp. aureus MRSA252 NCBI   transposon Tn554 hypothetical protein
gi|49482297 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR0049
gi|49483898 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR1734
gi|57636510 Staphylococcus epidermidis RP62A NCBI   hypothetical protein SERP2512
gi|57637766 Staphylococcus epidermidis RP62A NCBI   Tn554, hypothetical protein
gi|57637905 Staphylococcus epidermidis RP62A NCBI   Tn554, hypothetical protein
gi|57865852 Staphylococcus epidermidis RP62A NCBI   hypothetical protein SERP2512
gi|57867108 Staphylococcus epidermidis RP62A NCBI   Tn554 hypothetical protein
gi|57867247 Staphylococcus epidermidis RP62A NCBI   Tn554 hypothetical protein
gi|581278 Staphylococcus aureus NCBI   unnamed protein product
gi|70568194 Staphylococcus aureus NCBI   hypothetical protein
img|637092404 Staphylococcus aureus aureus N315 IMG   hypothetical protein within Tn554
img|637093148 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637093676 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637094138 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100162 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637153525 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637155147 Staphylococcus aureus aureus MRSA252 IMG   transposon Tn554 hypothetical protein
img|637167869 Staphylococcus epidermidis RP62A IMG   Tn554, hypothetical protein
img|637167990 Staphylococcus epidermidis RP62A IMG   Tn554, hypothetical protein
img|637169185 Staphylococcus epidermidis RP62A IMG   hypothetical protein
img|639107645 Staphylococcus aureus aureus JH1 IMG   Cyclopropane-fatty-acyl-phospholipid synthase:Methyltransferase small
img|640564373 Staphylococcus aureus aureus JH9 IMG   Methyltransferase type 12
img|640566055 Staphylococcus aureus aureus JH9 IMG   Methyltransferase type 12
img|640778112 Staphylococcus aureus aureus JH1 IMG   Methyltransferase type 12
img|640779824 Staphylococcus aureus aureus JH1 IMG   Methyltransferase type 12
img|640904384 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_0038 Staphylococcus aureus subsp. aureus JH1 KEGG   methyltransferase type 12
kegg|sah:SaurJH1_1746 Staphylococcus aureus subsp. aureus JH1 KEGG   methyltransferase type 12
kegg|saj:SaurJH9_0038 Staphylococcus aureus subsp. aureus JH9 KEGG   methyltransferase type 12
kegg|saj:SaurJH9_1712 Staphylococcus aureus subsp. aureus JH9 KEGG   methyltransferase type 12
kegg|sar:SAR0049   KEGG   hypothetical protein
kegg|sar:SAR1734   KEGG   hypothetical protein
kegg|sau:SA0767   KEGG   hypothetical protein
kegg|sau:SA1479   KEGG   hypothetical protein
kegg|sau:SA1950   KEGG   hypothetical protein
kegg|sau:SA2383   KEGG   hypothetical protein
kegg|sav:SAV1653   KEGG   hypothetical protein
kegg|saw:SAHV_1640 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|ser:SERP1218 Staphylococcus epidermidis RP62A KEGG   Tn554 hypothetical protein
kegg|ser:SERP1341 Staphylococcus epidermidis RP62A KEGG   Tn554 hypothetical protein
kegg|ser:SERP2512 Staphylococcus epidermidis RP62A KEGG   hypothetical protein
ref|NP_372177.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1653
ref|NP_374026.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0767
ref|NP_374766.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1479
ref|NP_375255.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1950
ref|NP_375709.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2383
ref|YP_001245426.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   methyltransferase type 12
ref|YP_001247078.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   methyltransferase type 12
ref|YP_001315191.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   methyltransferase type 12
ref|YP_001316877.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   methyltransferase type 12
ref|YP_001442230.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1640
ref|YP_039521.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR0049
ref|YP_041122.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR1734
ref|YP_188792.1 Staphylococcus epidermidis RP62A RefSeq   Tn554 hypothetical protein
ref|YP_188913.1 Staphylococcus epidermidis RP62A RefSeq   Tn554 hypothetical protein
ref|YP_190054.1 Staphylococcus epidermidis RP62A RefSeq   hypothetical protein SERP2512
ref|ZP_03562770.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_04848
ref|ZP_03564585.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_00480
ref|ZP_05143451.1 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00235
ref|ZP_05145041.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_08225
ref|ZP_05604835.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   conserved hypothetical protein
ref|ZP_05607974.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   conserved hypothetical protein
ref|ZP_05642711.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680661.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05685382.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05695488.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696442.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699936.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05702522.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5INS7 Staphylococcus aureus (strain JH9) TrEMBL   Methyltransferase type 12
tr|A6TXI6 Staphylococcus aureus (strain JH1) TrEMBL   Methyltransferase type 12
tr|A7X371 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q48363 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein
tr|Q5HNP8 Staphylococcus epidermidis (strain ATCC 35984 / RP62A) TrEMBL   Putative uncharacterized protein
tr|Q6GKQ1 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q7A6M5 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0767
tr|Q7DIC1 Staphylococcus aureus TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search