The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2431: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: M42 glutamyl aminopeptidase, cellulase
Translate Function Assignments



Context on contig NC_002745 from base 2514441 to 2528075 (13635 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2426 2514441 2516078 1638 +           Amino acid-proton symporter YbeC # putative locus|SA2239, protein_id|NP_375562.1, gi|15928029, geneID|1125166
2427 2516387 2517739 1353 + 308         Carboxylesterase, type B locus|SA2240, protein_id|NP_375563.1, gi|15928030, geneID|1125167
2428 2518988 2517801 1188 - 61     1: 2   Uncharacterized MFS-type transporter locus|SA2241, protein_id|NP_375564.1, gi|15928031, geneID|1125168
2429 2520160 2519384 777 - 395     1: 1   Probable iron export permease protein FetB locus|SA2242, protein_id|NP_375565.1, gi|15928032, geneID|1125169
2430 2520815 2520153 663 - -8     1: 1   Probable iron export ATP-binding protein FetA locus|SA2243, protein_id|NP_375566.1, gi|15928033, geneID|1125170
2431 2522139 2521063 1077 - 247         M42 glutamyl aminopeptidase, cellulase locus|SA2244, protein_id|NP_375567.1, gi|15928034, geneID|1125171
2432 2522760 2522494 267 - 354         YoeB toxin protein locus|SA2245, protein_id|NP_375568.1, gi|15928035, geneID|1125172
2433 2523017 2522760 258 - -1         YefM protein (antitoxin to YoeB) locus|SA2246, protein_id|NP_375569.1, gi|15928036, geneID|1125173
2434 2523376 2523831 456 + 358         FIG01108263: hypothetical protein locus|SA2247, protein_id|NP_375570.1, gi|15928037, geneID|1125174
2435 2525576 2523999 1578 - 167     2: 3 5   Glutamate synthase (ferredoxin) (EC 1.4.7.1) locus|SA2248, protein_id|NP_375571.1, gi|15928038, geneID|1125175
2436 2525771 2526520 750 + 194         Uncharacterized protein SAV2460 locus|SA2249, protein_id|NP_375572.1, gi|15928039, geneID|1125176
2437 2526827 2526669 159 - 148         Doubtful CDS locus|SAS087, protein_id|NP_375573.1, gi|15928040, geneID|1125177
2438 2528075 2526882 1194 - 54     2: 2 4   Staphylopine exporter, MFS-family locus|SA2250, protein_id|NP_375574.1, gi|15928041, geneID|1125178

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.2431 M42 glutamyl aminopeptidase, cellulase
MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
NRYGCALAVEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW

MD5 = 009eb46b64fcbae10c1ce774c84ed31e


  DNA Sequence

>fig|158879.11.peg.2431 M42 glutamyl aminopeptidase, cellulase
atgaatcagtcagtcaaattacttaaacatttaacagatgtaaacggcattgctggttat
gaaatgcaagttaaagaagcaatgcgtaactatatagagcctgtcagtgatcaaattatt
gaagataacttgggtggcatttttggaaagaaaaatgctgagaatggtcaatactcaatt
atgatttctggtcatatggatgaagttggttttatggtaacaaagattgataaacatggt
tttatttcatttacgccagttggtggatggtggaatcaagtcatgctatctcaaaaagta
acgattacaacagattcgggcaaagaaattagaggtatcatcggttctaaaccgccacat
gtcttaacgcctgaagaacgtaaaaagccaatggaaatcaaaaatatgtttatagatatt
ggtgttagtagcaaggaagaagctgaagaagctggcgttgaagtaggcaatatggtaacg
ccatatagtgaatttgaagtgcttgcaaatgataaatatttaactgcgaaagcatttgat
aatcgctatggctgtgcattagctgttgaggtattaaaacgtttaaaagatgaaaatatt
ggaattaacttatacagtggtgccacagtgcaagaagaagttggtttgcgtggtgcgaaa
gtggcagcgaatacaattaaaccagatttggcgatagctgtcgatgtaggtattgcttat
gataccccaggtatgtcaggtcaaacgagcgatagtaaactaggcggtggtccagttgtc
attatgatggatgctacaagtattgctcaccaaggtttgcgtaagcatattaaagatgta
gctaaggaacataacatcgaagtacaatgggatacgacaccaggtggaggtacagatgcg
ggaagtattcatgtcgcaaatgaaggtattccaacgatgacaatcggtgttacgctgcga
tacatgcattctaatgtttcagtgctcaatgtagatgattatgaaaattctatccgtctt
gttactgaaattgtccgttcattgaatgatgaaagttataaaaatatcatgtggtaa


  DNA with Flanking Sequence

>fig|158879.11.peg.2431 M42 glutamyl aminopeptidase, cellulase
aaataacacaatcttttgaaaaattagagcctaaatatttagagcgatattcaagaagaa
ttaaccatcagcacagggtcgtctataccgtagatgatcgaaataaagaagtattaatac
tatcggcatggtcacattatgattaatgaatattcaatatctgaataactttaatggtaa
gttaattaaagaaactagtatttaagtgtagggaaaatagcgacgttaatgcgttgttat
ctctacactttttaattttataatagcgcaagactaaacaaattgaaattagtaacaata
aaagaataacatattataataaggaattttaaattgtgactttttcggaatattaaattt
taaaaatatgaggtttttgaagcggatttctcacaaaattttaaaaaatttaagcctgaa
aatgataaagcggtagggaacgtttttctgaaagttagtgatacaatagttttaagttga
aatacaggaggatgaataacatgaatcagtcagtcaaattacttaaacatttaacagatg
taaacggcattgctggttatgaaatgcaagttaaagaagcaatgcgtaactatatagagc
ctgtcagtgatcaaattattgaagataacttgggtggcatttttggaaagaaaaatgctg
agaatggtcaatactcaattatgatttctggtcatatggatgaagttggttttatggtaa
caaagattgataaacatggttttatttcatttacgccagttggtggatggtggaatcaag
tcatgctatctcaaaaagtaacgattacaacagattcgggcaaagaaattagaggtatca
tcggttctaaaccgccacatgtcttaacgcctgaagaacgtaaaaagccaatggaaatca
aaaatatgtttatagatattggtgttagtagcaaggaagaagctgaagaagctggcgttg
aagtaggcaatatggtaacgccatatagtgaatttgaagtgcttgcaaatgataaatatt
taactgcgaaagcatttgataatcgctatggctgtgcattagctgttgaggtattaaaac
gtttaaaagatgaaaatattggaattaacttatacagtggtgccacagtgcaagaagaag
ttggtttgcgtggtgcgaaagtggcagcgaatacaattaaaccagatttggcgatagctg
tcgatgtaggtattgcttatgataccccaggtatgtcaggtcaaacgagcgatagtaaac
taggcggtggtccagttgtcattatgatggatgctacaagtattgctcaccaaggtttgc
gtaagcatattaaagatgtagctaaggaacataacatcgaagtacaatgggatacgacac
caggtggaggtacagatgcgggaagtattcatgtcgcaaatgaaggtattccaacgatga
caatcggtgttacgctgcgatacatgcattctaatgtttcagtgctcaatgtagatgatt
atgaaaattctatccgtcttgttactgaaattgtccgttcattgaatgatgaaagttata
aaaatatcatgtggtaatcaaatccataaataataaagaatccttttaatatggtaggtt
gttaaacaattgtctaactttaattcttagtcattagacagtatccatgttaataggatt
ttttgtttttaatttaaatgctgaaaatcaattatgcctaaattttgatattacaagaaa
atgattttttcttaaatgtaattgcactaaaaaccaaaaaaacgggaataatatacctga
tatattacatgaggagcggtgcaaatgttgttagaaattaaagatttagtgtataaagcg
agcgatagaatcatactagatcatatcagtctaaaagtagataaaggcgagagtattgcc
attataggtccatcaggtagtggtaaaagtacatttcaaaagcaaatatgtaatttgatt
agtccaactagtggagaactttattttaaaggtaaaccctataatgattatgacccggaa
gaattgcgtcaacgaatcagttatttgatgcagcaaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0008152       P:metabolic process
GO:0008810       F:cellulase activity
cmr|NT01SA2478 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA2453 Staphylococcus aureus Mu50     endo-1,4-beta-glucanase
dbj|BAB43546.1 Staphylococcus aureus subsp. aureus N315     SA2244
dbj|BAB58617.1 Staphylococcus aureus subsp. aureus Mu50     endo-1,4-beta-glucanase
dbj|BAF79322.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2455 Staphylococcus aureus subsp. aureus Mu50 FIG   M42 glutamyl aminopeptidase, cellulase
fig|158878.14.peg.2541 Staphylococcus aureus subsp. aureus Mu50 FIG   M42 glutamyl aminopeptidase, cellulase
fig|158879.1.peg.2329 Staphylococcus aureus subsp. aureus N315 FIG   M42 glutamyl aminopeptidase, cellulase
fig|359786.13.peg.2621 Staphylococcus aureus subsp. aureus JH9 FIG   M42 glutamyl aminopeptidase, cellulase
fig|359786.3.peg.701 Staphylococcus aureus subsp. aureus JH9 FIG   M42 glutamyl aminopeptidase, cellulase
fig|359787.11.peg.2584 Staphylococcus aureus subsp. aureus JH1 FIG   M42 glutamyl aminopeptidase, cellulase
fig|359787.3.peg.1192 Staphylococcus aureus subsp. aureus JH1 FIG   M42 glutamyl aminopeptidase, cellulase
fig|418127.4.peg.2254 Staphylococcus aureus subsp. aureus Mu3 FIG   M42 glutamyl aminopeptidase, cellulase
fig|418127.6.peg.2504 Staphylococcus aureus subsp. aureus Mu3 FIG   M42 glutamyl aminopeptidase, cellulase
fig|505321.3.peg.247 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   M42 glutamyl aminopeptidase, cellulase
fig|553565.3.peg.1945 Staphylococcus aureus A5937 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553568.3.peg.2789 Staphylococcus aureus A6224 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553571.3.peg.1468 Staphylococcus aureus A6300 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553573.3.peg.849 Staphylococcus aureus A8115 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553574.3.peg.1246 Staphylococcus aureus A8117 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553577.3.peg.286 Staphylococcus aureus A8796 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553580.3.peg.287 Staphylococcus aureus A8819 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553581.3.peg.2435 Staphylococcus aureus A9299 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553588.3.peg.2525 Staphylococcus aureus A9719 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553592.3.peg.602 Staphylococcus aureus A9763 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553596.3.peg.1705 Staphylococcus aureus A9781 FIG   M42 glutamyl aminopeptidase, cellulase
fig|553601.3.peg.1953 Staphylococcus aureus A10102 FIG   M42 glutamyl aminopeptidase, cellulase
fig|585891.3.peg.2535 Staphylococcus aureus subsp. aureus Mu50-omega FIG   M42 glutamyl aminopeptidase, cellulase
fig|680649.3.peg.957 Staphylococcus aureus subsp. aureus MR1 FIG   M42 glutamyl aminopeptidase, cellulase
fig|681288.4.peg.2484 Staphylococcus aureus subsp. aureus ED98 FIG   M42 glutamyl aminopeptidase, cellulase
fig|703339.3.peg.2445 Staphylococcus aureus 04-02981 FIG   M42 glutamyl aminopeptidase, cellulase
gb|ABQ50259.1 Staphylococcus aureus subsp. aureus JH9     Cellulase
gb|ABR53355.1 Staphylococcus aureus subsp. aureus JH1     Cellulase
gb|EEV27107.1 Staphylococcus aureus A9781     cellulase
gb|EEV65438.1 Staphylococcus aureus A9763     cellulase
gb|EEV66065.1 Staphylococcus aureus A9719     cellulase
gb|EEV71367.1 Staphylococcus aureus A9299     endo-1,4-beta-glucanase
gb|EEV75909.1 Staphylococcus aureus A8115     cellulase
gb|EEV77461.1 Staphylococcus aureus A6300     endo-1,4-beta-glucanase
gb|EEV79439.1 Staphylococcus aureus A6224     endo-1,4-beta-glucanase
gb|EEV85164.1 Staphylococcus aureus A5937     endo-1,4-beta-glucanase
gi|13702405 Staphylococcus aureus subsp. aureus N315 NCBI   SA2244
gi|14248229 Staphylococcus aureus subsp. aureus Mu50 NCBI   endo-1,4-beta-glucanase
gi|147741961 Staphylococcus aureus subsp. aureus JH9 NCBI   Cellulase
gi|148268892 Staphylococcus aureus subsp. aureus JH9 NCBI   cellulase
gi|149947419 Staphylococcus aureus subsp. aureus JH1 NCBI   Cellulase
gi|150394967 Staphylococcus aureus subsp. aureus JH1 NCBI   cellulase
gi|156722905 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980770 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2439
gi|15925445 Staphylococcus aureus subsp. aureus Mu50 NCBI   endo-1,4-beta-glucanase
gi|15928034 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2244
gi|253314793 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_01200
gi|255007230 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_12195
gi|257788767 Staphylococcus aureus A9781 NCBI   cellulase
gi|257794795 Staphylococcus aureus A9781 NCBI   cellulase
gi|257840987 Staphylococcus aureus A9763 NCBI   cellulase
gi|257841628 Staphylococcus aureus A9719 NCBI   cellulase
gi|257847365 Staphylococcus aureus A9299 NCBI   endo-1,4-beta-glucanase
gi|257851975 Staphylococcus aureus A8115 NCBI   cellulase
gi|257854513 Staphylococcus aureus A6300 NCBI   endo-1,4-beta-glucanase
gi|257856530 Staphylococcus aureus A6224 NCBI   endo-1,4-beta-glucanase
gi|257862396 Staphylococcus aureus A5937 NCBI   endo-1,4-beta-glucanase
gi|258407475 Staphylococcus aureus A9763 NCBI   cellulase
gi|258422197 Staphylococcus aureus A9719 NCBI   cellulase
gi|258439589 Staphylococcus aureus A9299 NCBI   endo-1,4-beta-glucanase
gi|258442854 Staphylococcus aureus A8115 NCBI   cellulase
gi|258446445 Staphylococcus aureus A6300 NCBI   endo-1,4-beta-glucanase
gi|258450438 Staphylococcus aureus A6224 NCBI   endo-1,4-beta-glucanase
gi|258455185 Staphylococcus aureus A5937 NCBI   endo-1,4-beta-glucanase
img|637093997 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637101012 Staphylococcus aureus aureus Mu50 IMG   endo-1,4-beta-glucanase
img|639107354 Staphylococcus aureus aureus JH1 IMG   Cellulase( EC:3.2.1.4 )
img|640566867 Staphylococcus aureus aureus JH9 IMG   Cellulase( EC:3.2.1.4 )
img|640780642 Staphylococcus aureus aureus JH1 IMG   Cellulase( EC:3.2.1.4 )
img|640905237 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_2531 Staphylococcus aureus subsp. aureus JH1 KEGG   cellulase (EC:3.2.1.4)
kegg|saj:SaurJH9_2482 Staphylococcus aureus subsp. aureus JH9 KEGG   cellulase (EC:3.2.1.4)
kegg|sau:SA2244   KEGG   hypothetical protein
kegg|sav:SAV2455   KEGG   endo-1,4-beta-glucanase
kegg|saw:SAHV_2439 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372979.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   endo-1,4-beta-glucanase
ref|NP_375567.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2244
ref|YP_001247835.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   cellulase
ref|YP_001317642.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   cellulase
ref|YP_001443029.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2439
ref|ZP_04838006.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_01200
ref|ZP_05145831.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_12195
ref|ZP_05643774.1 Staphylococcus aureus A9781 RefSeq   cellulase
ref|ZP_05680618.1 Staphylococcus aureus A9763 RefSeq   cellulase
ref|ZP_05685109.1 Staphylococcus aureus A9719 RefSeq   cellulase
ref|ZP_05690335.1 Staphylococcus aureus A9299 RefSeq   endo-1,4-beta-glucanase
ref|ZP_05691414.1 Staphylococcus aureus A8115 RefSeq   cellulase
ref|ZP_05694600.1 Staphylococcus aureus A6300 RefSeq   endo-1,4-beta-glucanase
ref|ZP_05698530.1 Staphylococcus aureus A6224 RefSeq   endo-1,4-beta-glucanase
ref|ZP_05703145.1 Staphylococcus aureus A5937 RefSeq   endo-1,4-beta-glucanase
tr|A5IVN6 Staphylococcus aureus (strain JH9) TrEMBL   Cellulase
tr|A6U4I7 Staphylococcus aureus (strain JH1) TrEMBL   Cellulase
tr|A7X6A9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A3P2 Staphylococcus aureus (strain N315) TrEMBL   SA2244 protein
tr|Q99RH7 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Endo-1,4-beta-glucanase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search