The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2393: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Gamma-hemolysin component A
Translate Function Assignments



Context on contig NC_002745 from base 2471701 to 2484681 (12981 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2388 2473140 2471701 1440 -       2: 8 14   Uncharacterized MFS-type transporter locus|SA2203, protein_id|NP_375526.1, gi|15927993, geneID|1125131
2389 2473314 2473418 105 + 173         hypothetical protein  
2390 2474258 2473572 687 - 153     2: 13 7   Phosphoglycerate mutase (EC 5.4.2.11) locus|SA2204, protein_id|NP_375527.1, gi|15927994, geneID|1125132
2391 2475451 2474585 867 - 326     3: 6 11 10 dlit(30808698)
dlit(19226325)
Manganese efflux system protein MneS (= MntE) locus|SA2205, protein_id|NP_375528.1, gi|15927995, geneID|1125133
2392 2476080 2477390 1311 + 628         IgG-binding protein SBI gene_name|sbi, locus|SA2206, protein_id|NP_375529.1, gi|15927996, geneID|1125134
2393 2477890 2478855 966 + 499         Gamma-hemolysin component A gene_name|hlgA, locus|SA2207, protein_id|NP_375530.1, gi|15927997, geneID|1125135
2394 2479422 2480369 948 + 566       dlit(8423103) Cytolytic pore-forming protein S component => Gamma-hemolysin HlgC gene_name|hlgC, locus|SA2208, protein_id|NP_375531.1, gi|15927998, geneID|1125136
2395 2480371 2481348 978 + 1       dlit(3075655)
dlit(8423103)
Cytolytic pore-forming protein F component => Gamma-hemolysin HlgB gene_name|hlgB, locus|SA2209, protein_id|NP_375532.1, gi|15927999, geneID|1125137
2396 2481867 2481400 468 - 51         Uncharacterized protein SAV2422 locus|SA2210, protein_id|NP_375533.1, gi|15928000, geneID|1125138
2397 2482570 2481878 693 - 10     4: 2 3 4 1   Pimeloyl-CoA synthase (EC 6.2.1.14) locus|SA2211, protein_id|NP_375534.1, gi|15928001, geneID|1125139
2398 2483693 2482581 1113 - 10     5: 5 2 3 4 1   8-amino-7-oxononanoate synthase (EC 2.3.1.47) locus|SA2212, protein_id|NP_375535.1, gi|15928002, geneID|1125140
2399 2484681 2483674 1008 - -20     7: 5 2 12 3 4 1 9   Biotin synthase (EC 2.8.1.6) gene_name|bioB, locus|SA2213, protein_id|NP_375536.1, gi|15928003, geneID|1125141

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.2393 Gamma-hemolysin component A
MNLKLNRKKVISMIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQD
ITSKRLAITQNIQFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYN
ISLKTKDSNVDLINYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQ
KNYVTEVESQNSKGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPP
LIQSGFNPSFITTLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNV
TVKYEVNWKTHEVKIKSITPK

MD5 = 8e3f5eedfae702d7d52e1cba2f1a40fb


  DNA Sequence

>fig|158879.11.peg.2393 Gamma-hemolysin component A
atgaacttaaaattaaatagaaagaaagtgatttctatgattaaaaataaaatattaaca
gcaactttagcagttggtttaatagcccctttagccaatccatttatagaaatttctaaa
gcagaaaataagatagaagatatcggtcaaggtgcagaaatcatcaaaagaacacaagac
attactagcaaacgattagctataactcaaaacattcaatttgattttgtaaaagataaa
aaatataacaaagatgccctagttgttaagatgcaaggcttcatcagctctagaacaaca
tattcagacttaaaaaaatatccatatattaaaagaatgatatggccatttcaatataat
atcagtttgaaaacgaaagactctaatgttgatttaatcaattatcttcctaaaaataaa
attgattcagcagatgttagtcagaaattaggctataatatcggcggaaacttccaatca
gcgccatcaatcggaggcagtggctcattcaactactctaaaacaattagttataatcaa
aaaaactatgttactgaagtagaaagtcagaactctaaaggtgttaaatggggagtgaaa
gcaaattcatttgttacaccgaatggtcaagtatctgcatatgatcaatacttatttgca
caagacccaactggtccagcagcaagagactatttcgtcccagataatcaattacctcct
ttaattcaaagtggctttaatccatcatttattacaacattgtcacacgaaagaggtaaa
ggtgataaaagcgagtttgaaatcacttacggcagaaacatggatgctacatatgcttac
gtgacaagacatcgtttagccgttgatagaaaacatgatgcttttaaaaaccgaaacgtt
acagttaaatatgaagtgaactggaaaacacatgaagtaaaaattaaaagcatcacacct
aagtaa


  DNA with Flanking Sequence

>fig|158879.11.peg.2393 Gamma-hemolysin component A
atcaatcaaaaatatcttctctagttttacatcattttttaaataattttcgtaataaac
cgtgattaaaaagaaccgctgattctcaatcgaatctgtggttctttttttattttccat
caattaaatgtttcttcgctatttgtcagtccacttctttacctgcaacttgttaaataa
tccttacatcgttaacgaatagttcatcatttagttgaatcagctcaactttattaactt
caaattttcacaaactattgcgaaatccattcctcttccactacaagcaccataattaaa
caacaattcaatagaataagacttgcaaaacatagttatgtcgctatataaacgcctgcg
accaataaatcttttaaacataacataatgcaaaaacatcatttaacaatgctaaaaatg
tctcttcaatacatgttgatagtaattaacttttaacgaacagttaattcgaaaacgctt
acaaatggattattatatatatgaacttaaaattaaatagaaagaaagtgatttctatga
ttaaaaataaaatattaacagcaactttagcagttggtttaatagcccctttagccaatc
catttatagaaatttctaaagcagaaaataagatagaagatatcggtcaaggtgcagaaa
tcatcaaaagaacacaagacattactagcaaacgattagctataactcaaaacattcaat
ttgattttgtaaaagataaaaaatataacaaagatgccctagttgttaagatgcaaggct
tcatcagctctagaacaacatattcagacttaaaaaaatatccatatattaaaagaatga
tatggccatttcaatataatatcagtttgaaaacgaaagactctaatgttgatttaatca
attatcttcctaaaaataaaattgattcagcagatgttagtcagaaattaggctataata
tcggcggaaacttccaatcagcgccatcaatcggaggcagtggctcattcaactactcta
aaacaattagttataatcaaaaaaactatgttactgaagtagaaagtcagaactctaaag
gtgttaaatggggagtgaaagcaaattcatttgttacaccgaatggtcaagtatctgcat
atgatcaatacttatttgcacaagacccaactggtccagcagcaagagactatttcgtcc
cagataatcaattacctcctttaattcaaagtggctttaatccatcatttattacaacat
tgtcacacgaaagaggtaaaggtgataaaagcgagtttgaaatcacttacggcagaaaca
tggatgctacatatgcttacgtgacaagacatcgtttagccgttgatagaaaacatgatg
cttttaaaaaccgaaacgttacagttaaatatgaagtgaactggaaaacacatgaagtaa
aaattaaaagcatcacacctaagtaaacagttcaatcattttaaaaaatcctgggacact
tcatacttgtctcaggattttttaacatattgaatcagcctcataacattaaattaattt
atcgtacattaaatttaataataacaactgatttttataagaacaaagtatcgcaccaga
gtagatacacaaataatacaaatgaatccatttaagttgaaagcttaaataaatattctc
aagttaataaataattaacttttagatggattcatcaaaaatcgtaaaaagaacaatttg
tattttacaaacattaattaaaaataaaagcaagacattcgtgcaatcggttaccttaaa
ttgtttacaactgtcaacaataccaaggttttattaactatatttctcacaaaattagct
tttagcattccaaacaaaaaaggttaaattgaacggaattatggcatttttaacttaatt
gtaaaaaaagttgataatggtcaattgttaatgaacagttaattat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005576       C:extracellular region
GO:0009405       P:pathogenesis
GO:0051715       P:cytolysis of cells of another organism
cmr|NT05SA2439 Staphylococcus aureus NCTC 8325     bi-component toxin
fig|158878.14.peg.2504 Staphylococcus aureus subsp. aureus Mu50 FIG   Gamma-hemolysin component A
fig|196620.5.peg.2419 Staphylococcus aureus subsp. aureus MW2 FIG   Gamma-hemolysin component A
fig|282459.5.peg.2403 Staphylococcus aureus subsp. aureus MSSA476 FIG   Gamma-hemolysin component A
fig|359786.13.peg.2584 Staphylococcus aureus subsp. aureus JH9 FIG   Gamma-hemolysin component A
fig|359786.3.peg.1507 Staphylococcus aureus subsp. aureus JH9 FIG   Gamma-hemolysin component A
fig|359787.11.peg.2547 Staphylococcus aureus subsp. aureus JH1 FIG   Gamma-hemolysin component A
fig|359787.3.peg.654 Staphylococcus aureus subsp. aureus JH1 FIG   Gamma-hemolysin component A
fig|418127.4.peg.2220 Staphylococcus aureus subsp. aureus Mu3 FIG   Gamma-hemolysin component A
fig|418127.6.peg.2467 Staphylococcus aureus subsp. aureus Mu3 FIG   Gamma-hemolysin component A
fig|426430.6.peg.2246 Staphylococcus aureus subsp. aureus str. Newman FIG   Gamma-hemolysin component A
fig|426430.8.peg.2522 Staphylococcus aureus subsp. aureus str. Newman FIG   Gamma-hemolysin component A
fig|451515.3.peg.2523 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Gamma-hemolysin component A
fig|451516.9.peg.2512 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Gamma-hemolysin component A
fig|452948.4.peg.533 Staphylococcus aureus 930918-3 FIG   Gamma-hemolysin component A
fig|455227.3.peg.790 Staphylococcus aureus D30 FIG   Gamma-hemolysin component A
fig|505321.3.peg.206 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Gamma-hemolysin component A
fig|546342.3.peg.1526 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Gamma-hemolysin component A
fig|546343.3.peg.1332 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Gamma-hemolysin component A
fig|548474.3.peg.458 Staphylococcus aureus subsp. aureus TCH130 FIG   Gamma-hemolysin component A
fig|548475.3.peg.1747 Staphylococcus aureus subsp. aureus TCH70 FIG   Gamma-hemolysin component A
fig|553565.3.peg.1982 Staphylococcus aureus A5937 FIG   Gamma-hemolysin component A
fig|553568.3.peg.2752 Staphylococcus aureus A6224 FIG   Gamma-hemolysin component A
fig|553571.3.peg.1505 Staphylococcus aureus A6300 FIG   Gamma-hemolysin component A
fig|553573.3.peg.812 Staphylococcus aureus A8115 FIG   Gamma-hemolysin component A
fig|553577.3.peg.249 Staphylococcus aureus A8796 FIG   Gamma-hemolysin component A
fig|553580.3.peg.250 Staphylococcus aureus A8819 FIG   Gamma-hemolysin component A
fig|553581.3.peg.2472 Staphylococcus aureus A9299 FIG   Gamma-hemolysin component A
fig|553588.3.peg.2562 Staphylococcus aureus A9719 FIG   Gamma-hemolysin component A
fig|553590.4.peg.1026 Staphylococcus aureus A9754 FIG   Gamma-hemolysin component A
fig|553592.3.peg.565 Staphylococcus aureus A9763 FIG   Gamma-hemolysin component A
fig|553594.3.peg.377 Staphylococcus aureus A9765 FIG   Gamma-hemolysin component A
fig|553596.3.peg.1668 Staphylococcus aureus A9781 FIG   Gamma-hemolysin component A
fig|553601.3.peg.1916 Staphylococcus aureus A10102 FIG   Gamma-hemolysin component A
fig|585155.3.peg.964 Staphylococcus aureus subsp. aureus H19 FIG   Gamma-hemolysin component A
fig|585891.3.peg.2498 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Gamma-hemolysin component A
fig|644279.4.peg.2563 Staphylococcus aureus subsp. aureus 132 FIG   Gamma-hemolysin component A
fig|681288.4.peg.2447 Staphylococcus aureus subsp. aureus ED98 FIG   Gamma-hemolysin component A
fig|703339.3.peg.2408 Staphylococcus aureus 04-02981 FIG   Gamma-hemolysin component A
fig|762962.3.peg.2088 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Gamma-hemolysin component A
fig|93061.5.peg.2451 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Gamma-hemolysin component A
fig|93062.19.peg.2361 Staphylococcus aureus subsp. aureus COL FIG   Gamma-hemolysin component A
gb|ABQ50222.1 Staphylococcus aureus subsp. aureus JH9     beta-channel forming cytolysin
gb|ABR53317.1 Staphylococcus aureus subsp. aureus JH1     beta-channel forming cytolysin
gb|ABX30392.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     gamma-hemolysin component A
gb|EES55983.1 Staphylococcus aureus subsp. aureus TCH70     gamma-hemolysin component A
gb|EES94911.1 Staphylococcus aureus subsp. aureus USA300_TCH959     gamma-hemolysin component A
gb|EES96586.1 Staphylococcus aureus subsp. aureus TCH130     gamma-hemolysin component A
gb|EEV27071.1 Staphylococcus aureus A9781     gamma-hemolysin component A
gb|EEV65402.1 Staphylococcus aureus A9763     gamma-hemolysin component A
gb|EEV66101.1 Staphylococcus aureus A9719     gamma-hemolysin component A
gb|EEV71402.1 Staphylococcus aureus A9299     gamma-hemolysin component A
gb|EEV75874.1 Staphylococcus aureus A8115     gamma-hemolysin component A
gb|EEV77497.1 Staphylococcus aureus A6300     gamma-hemolysin component A
gb|EEV79403.1 Staphylococcus aureus A6224     gamma-hemolysin component A
gb|EEV85201.1 Staphylococcus aureus A5937     beta-channel forming cytolysin
gi|147741924 Staphylococcus aureus subsp. aureus JH9 NCBI   beta-channel forming cytolysin
gi|148268855 Staphylococcus aureus subsp. aureus JH9 NCBI   beta-channel forming cytolysin
gi|149947381 Staphylococcus aureus subsp. aureus JH1 NCBI   beta-channel forming cytolysin
gi|150394929 Staphylococcus aureus subsp. aureus JH1 NCBI   beta-channel forming cytolysin
gi|160369421 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   gamma-hemolysin component A
gi|161510612 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   gamma-hemolysin component A
gi|221138503 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   gamma-hemolysin component A
gi|221141302 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   gamma-hemolysin component A
gi|251803326 Staphylococcus aureus subsp. aureus TCH70 NCBI   gamma-hemolysin component A
gi|251813143 Staphylococcus aureus subsp. aureus TCH70 NCBI   gamma-hemolysin component A
gi|253314757 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   gamma-hemolysin component A
gi|253726182 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   gamma-hemolysin component A
gi|253727857 Staphylococcus aureus subsp. aureus TCH130 NCBI   gamma-hemolysin component A
gi|253730095 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   gamma-hemolysin component A
gi|253734162 Staphylococcus aureus subsp. aureus TCH130 NCBI   gamma-hemolysin component A
gi|255007194 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   gamma-hemolysin component A
gi|257788731 Staphylococcus aureus A9781 NCBI   gamma-hemolysin component A
gi|257794759 Staphylococcus aureus A9781 NCBI   gamma-hemolysin component A
gi|257840951 Staphylococcus aureus A9763 NCBI   gamma-hemolysin component A
gi|257841664 Staphylococcus aureus A9719 NCBI   gamma-hemolysin component A
gi|257847400 Staphylococcus aureus A9299 NCBI   gamma-hemolysin component A
gi|257851940 Staphylococcus aureus A8115 NCBI   gamma-hemolysin component A
gi|257854549 Staphylococcus aureus A6300 NCBI   gamma-hemolysin component A
gi|257856494 Staphylococcus aureus A6224 NCBI   gamma-hemolysin component A
gi|257862433 Staphylococcus aureus A5937 NCBI   beta-channel forming cytolysin
gi|258407439 Staphylococcus aureus A9763 NCBI   gamma-hemolysin component A
gi|258422233 Staphylococcus aureus A9719 NCBI   gamma-hemolysin component A
gi|258439624 Staphylococcus aureus A9299 NCBI   gamma-hemolysin component A
gi|258442819 Staphylococcus aureus A8115 NCBI   gamma-hemolysin component A
gi|258446481 Staphylococcus aureus A6300 NCBI   gamma-hemolysin component A
gi|258450402 Staphylococcus aureus A6224 NCBI   gamma-hemolysin component A
gi|258455222 Staphylococcus aureus A5937 NCBI   beta-channel forming cytolysin
img|639109468 Staphylococcus aureus aureus JH1 IMG   bi-component toxin
img|640566830 Staphylococcus aureus aureus JH9 IMG   beta-channel forming cytolysin
img|640780604 Staphylococcus aureus aureus JH1 IMG   beta-channel forming cytolysin
img|641310406 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   gamma-hemolysin component A
img|641771595 Staphylococcus aureus aureus USA300_TCH959 IMG   gamma-hemolysin component A
kegg|sah:SaurJH1_2493 Staphylococcus aureus subsp. aureus JH1 KEGG   beta-channel forming cytolysin
kegg|saj:SaurJH9_2445 Staphylococcus aureus subsp. aureus JH9 KEGG   beta-channel forming cytolysin
kegg|sax:USA300HOU_2402 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   gamma-hemolysin component A
ref|YP_001247798.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   beta-channel forming cytolysin
ref|YP_001317604.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   beta-channel forming cytolysin
ref|YP_001576271.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   gamma-hemolysin component A
ref|ZP_03563305.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   gamma-hemolysin component A
ref|ZP_03565795.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   gamma-hemolysin component A
ref|ZP_04827616.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   gamma-hemolysin component A
ref|ZP_04837970.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   gamma-hemolysin component A
ref|ZP_04864260.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   gamma-hemolysin component A
ref|ZP_04868327.1 Staphylococcus aureus subsp. aureus TCH130 RefSeq   gamma-hemolysin component A
ref|ZP_05145795.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   gamma-hemolysin component A
ref|ZP_05643738.1 Staphylococcus aureus A9781 RefSeq   gamma-hemolysin component A
ref|ZP_05680582.1 Staphylococcus aureus A9763 RefSeq   gamma-hemolysin component A
ref|ZP_05685145.1 Staphylococcus aureus A9719 RefSeq   gamma-hemolysin component A
ref|ZP_05690370.1 Staphylococcus aureus A9299 RefSeq   gamma-hemolysin component A
ref|ZP_05691379.1 Staphylococcus aureus A8115 RefSeq   gamma-hemolysin component A
ref|ZP_05694636.1 Staphylococcus aureus A6300 RefSeq   gamma-hemolysin component A
ref|ZP_05698494.1 Staphylococcus aureus A6224 RefSeq   gamma-hemolysin component A
ref|ZP_05703182.1 Staphylococcus aureus A5937 RefSeq   beta-channel forming cytolysin
tr|A5IVJ9 Staphylococcus aureus (strain JH9) TrEMBL   Beta-channel forming cytolysin precursor
tr|A6U4E9 Staphylococcus aureus (strain JH1) TrEMBL   Beta-channel forming cytolysin precursor
tr|A8YYG8 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Gamma-hemolysin component A
tr|C5MZW8 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Gamma-hemolysin component A
tr|C5Q2F8 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   Gamma-hemolysin component A
tr|C5QFQ0 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Gamma-hemolysin component A


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search