The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2361: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Nitrate/nitrite transporter NarT
Translate Function Assignments



Context on contig NC_002745 from base 2437337 to 2450603 (13267 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2354 2437337 2439442 2106 +           AraC family regulatory protein locus|SA2169, protein_id|NP_375492.1, gi|15927959, geneID|1125097
2355 2439513 2439935 423 + 70         Pyridoxamine 5'-phosphate oxidase like general stress protein locus|SA2170, protein_id|NP_375493.1, gi|15927960, geneID|1125098
2356 2440199 2440555 357 + 263         FIG01108504: hypothetical protein locus|SA2171, protein_id|NP_375494.1, gi|15927961, geneID|1125099
2357 2442150 2440873 1278 - 317     1: 4   Proton/glutamate symport protein @ Sodium/glutamate symport protein gene_name|gltT, locus|SA2172, protein_id|NP_375495.1, gi|15927962, geneID|1125100
2358 2442697 2442332 366 - 181         FIG01108216: hypothetical protein locus|SA2173, protein_id|NP_375496.1, gi|15927963, geneID|1125101
2359 2443094 2443540 447 + 396         Transcriptional regulator SarZ (Staphylococcal accessory regulator Z) locus|SA2174, protein_id|NP_375497.1, gi|15927964, geneID|1125102
2360 2443747 2444184 438 + 206         Molecular chaperone, small heat shock protein locus|SA2175, protein_id|NP_375498.1, gi|15927965, geneID|1125103
2361 2445460 2444291 1170 - 106     3: 2 1 3   Nitrate/nitrite transporter NarT gene_name|narK, locus|SA2176, protein_id|NP_375499.1, gi|15927966, geneID|1125104
2362 2445829 2446743 915 + 368         FIG01108860: hypothetical protein locus|SA2177, protein_id|NP_375500.1, gi|15927967, geneID|1125105
2363 2446722 2447462 741 + -22         Transcriptional regulator, MerR family locus|SA2178, protein_id|NP_375501.1, gi|15927968, geneID|1125106
2364 2448322 2447720 603 - 257         response regulator locus|SA2179, protein_id|NP_375502.1, gi|15927969, geneID|1125107
2365 2449430 2448396 1035 - 73       dlit(18820014) Oxygen-sensing two-component system sensor histidine kinase NreB locus|SA2180, protein_id|NP_375503.1, gi|15927970, geneID|1125108
2366 2449906 2449454 453 - 23       dlit(18820014) Oxygen-sensing, dissimilatory nitrate and nitrite reduction regulatory protein NreA locus|SA2181, protein_id|NP_375504.1, gi|15927971, geneID|1125109
2367 2450603 2449926 678 - 19     3: 2 1 3   Respiratory nitrate reductase (quinone) gamma subunit (EC 1.7.5.1) gene_name|narI, locus|SA2182, protein_id|NP_375505.1, gi|15927972, geneID|1125110

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Nitrate_and_nitrite_ammonification rodionov Nitrate/nitrite transporter
HGM_respiration Nitrate/nitrite transporter NarT
Metabolism_of_Nitrogen_Oxides_PanGenomes Ravcheev_Dmitry_user Nitrate/nitrite transporter NarT


  Protein Sequence

>fig|158879.11.peg.2361 Nitrate/nitrite transporter NarT
MYKTKGGFQLTLQTLSLVVGFMAWSIIAPLMPFIKQDVNVTEGQISIILAIPVILGSVLR
VPFGYLTNIVGAKWVFFTSFIVLLFPIFFLSQAQTPGMLMASGFFLGVGGAIFSVGVTSV
PKYFPKEKVGLANGIYGMGNIGTAVSSFLAPPIAGIIGWQTTVRSYLIIIALFALIMFIF
GDTQERKIKVPLMAQMKTLSKNYKLYYLSYWYFITFGAFVAFGIFLPNYLVNHFGIDKVD
AGIRSGVFIALATFLRPIGGILGDKFNAVKVLMIDFVIMIIGAVILGISDHIALFTVGCL
TISICAGIGNGLIFKLVPSYFSNEAGSANGIVSMMGGLGGFFPPLVITYVANLTGSSHLA
FIFLAVFGCIALFTMRHLYQKEYGSLKHS

MD5 = e5a09dccab1a721539e169caf1ad0398


  DNA Sequence

>fig|158879.11.peg.2361 Nitrate/nitrite transporter NarT
atgtacaaaacaaaaggtggctttcaacttacattacaaacattaagtttagtggttggg
tttatggcttggagtataattgcgccattaatgccctttattaaacaagatgtcaatgtt
actgaaggtcaaatatcaatcattttagcgataccagttattttgggatcagtgctccgt
gtgccatttggttatttaacaaatattgttggtgctaaatgggtattctttacaagtttt
atcgtattgttattcccgatatttttcttaagccaagcacaaacgccgggtatgttaatg
gcatcaggatttttccttggcgtaggtggcgcaattttctctgttggtgttacatcagtt
cctaaatatttcccaaaagaaaaagtaggtctagcaaatggtatttatggtatggggaat
atcggtacagcagtttcttcatttttagcaccaccgatagcgggtattattggttggcaa
acaacagttagaagttacttaattattatcgctttatttgcattaattatgttcattttt
ggtgacacacaagaacgtaaaattaaagtgccattaatggcccaaatgaaaacattatct
aaaaactacaaattatattacttaagttattggtatttcattacttttggtgcttttgta
gcatttggtattttcttacctaactacttagtaaatcattttggaattgacaaagtagat
gctggtattcgttcaggtgtattcattgcgctggcaacattcttgagaccaataggtggt
atactaggtgataaatttaatgcagttaaagtactgatgattgattttgttattatgatt
atcggtgccgttattttaggtatttcagaccatatcgcattattcactgtaggctgttta
acaataagtatttgtgcaggtattggtaacggcttaatttttaaattagtaccatcctac
ttctcaaatgaagcaggatcagcaaatggtatcgtatcaatgatgggtggtttaggagga
ttcttcccaccgttggtcatcacatacgtagctaatttaacaggttcaagccatttagca
tttattttcttagcggtatttggatgcattgcattatttaccatgcgccatttatatcaa
aaagaatatggttcattgaaacacagttga


  DNA with Flanking Sequence

>fig|158879.11.peg.2361 Nitrate/nitrite transporter NarT
atgttgtacctcaaatttctttttaaaaggtactaatatttctttagtgaaaattgaatc
acggtcgtttattggtgccttgagtatattcttatagacggaatctgatctaataatatt
gattttatacatgataaacctccttatgttgtcagcataaaggataacgtaacgtgattt
tcaagcagtaattgtaactaattgaaaaaaataagaaaagtatgtgagtgttcctaaata
atatgattaaaatgatggcgaataagtgtctaaaagcatcttaaagggacattgtatagg
gtaaatcacttcataaataagggaaaatccttatgttcactttttcacaatcataataaa
atatatatgtagtcaatactttgtctatattgaatgttttcatataaatgaaagcatttt
taaataacattgacctctaatatataggcagagtattgatatctattaaaaaataaatga
ttttgatgaaggtgaaacgtatgtacaaaacaaaaggtggctttcaacttacattacaaa
cattaagtttagtggttgggtttatggcttggagtataattgcgccattaatgcccttta
ttaaacaagatgtcaatgttactgaaggtcaaatatcaatcattttagcgataccagtta
ttttgggatcagtgctccgtgtgccatttggttatttaacaaatattgttggtgctaaat
gggtattctttacaagttttatcgtattgttattcccgatatttttcttaagccaagcac
aaacgccgggtatgttaatggcatcaggatttttccttggcgtaggtggcgcaattttct
ctgttggtgttacatcagttcctaaatatttcccaaaagaaaaagtaggtctagcaaatg
gtatttatggtatggggaatatcggtacagcagtttcttcatttttagcaccaccgatag
cgggtattattggttggcaaacaacagttagaagttacttaattattatcgctttatttg
cattaattatgttcatttttggtgacacacaagaacgtaaaattaaagtgccattaatgg
cccaaatgaaaacattatctaaaaactacaaattatattacttaagttattggtatttca
ttacttttggtgcttttgtagcatttggtattttcttacctaactacttagtaaatcatt
ttggaattgacaaagtagatgctggtattcgttcaggtgtattcattgcgctggcaacat
tcttgagaccaataggtggtatactaggtgataaatttaatgcagttaaagtactgatga
ttgattttgttattatgattatcggtgccgttattttaggtatttcagaccatatcgcat
tattcactgtaggctgtttaacaataagtatttgtgcaggtattggtaacggcttaattt
ttaaattagtaccatcctacttctcaaatgaagcaggatcagcaaatggtatcgtatcaa
tgatgggtggtttaggaggattcttcccaccgttggtcatcacatacgtagctaatttaa
caggttcaagccatttagcatttattttcttagcggtatttggatgcattgcattattta
ccatgcgccatttatatcaaaaagaatatggttcattgaaacacagttgatatgtaatac
atgacattcatttagttaaatacaaagccttaatatcatgcacaatattcgtagcatgac
attaaggctttagtagtgtattcattttaaatttaactatgaaattggaatagatgttga
tgaagtagtttcattgcttggtttgattttaggcaatgtaatggttaataacccattttc
aaaactagcagtaatatgttgcttatcaacagcttcaaaatcaaattgacgcattaatga
ttcgaagttacgctcatctaaaatgagttgttcagatttgtattttgcgcttctagtagc
ttgaatagtgagcgtattattattgaaatcgatactaatatcttctttatttacacctgc
tagttcagcttctaagtaatataattcgtctgtttcatatatattcgttacaaatgaagg
tgttgaaaagtaattaaatacttgtttacctaaatctttaaatgtatcacttggattacc
gttaaaaaag


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005886       C:plasma membrane
GO:0006810       P:transport
GO:0016021       C:integral to membrane
GO:0042128       P:nitrate assimilation
cmr|NT01SA2402 Staphylococcus aureus N315     nitrite extrusion protein [imported]
cmr|NT02SA2387 Staphylococcus aureus Mu50     nitrite extrusion protein
dbj|BAB43478.1 Staphylococcus aureus subsp. aureus N315     nitrite extrusion protein
dbj|BAB58550.1 Staphylococcus aureus subsp. aureus Mu50     nitrite extrusion protein
dbj|BAF79255.1 Staphylococcus aureus subsp. aureus Mu3     nitrite extrusion protein
fig|158878.1.peg.2388 Staphylococcus aureus subsp. aureus Mu50 FIG   Nitrate/nitrite transporter NarT
fig|158878.14.peg.2471 Staphylococcus aureus subsp. aureus Mu50 FIG   Nitrate/nitrite transporter NarT
fig|158879.1.peg.2261 Staphylococcus aureus subsp. aureus N315 FIG   Nitrate/nitrite transporter NarT
fig|359786.13.peg.2551 Staphylococcus aureus subsp. aureus JH9 FIG   Nitrate/nitrite transporter NarT
fig|359786.3.peg.653 Staphylococcus aureus subsp. aureus JH9 FIG   Nitrate/nitrite transporter NarT
fig|359787.11.peg.2513 Staphylococcus aureus subsp. aureus JH1 FIG   Nitrate/nitrite transporter NarT
fig|359787.3.peg.1521 Staphylococcus aureus subsp. aureus JH1 FIG   Nitrate/nitrite transporter NarT
fig|418127.4.peg.2192 Staphylococcus aureus subsp. aureus Mu3 FIG   Nitrate/nitrite transporter NarT
fig|418127.6.peg.2435 Staphylococcus aureus subsp. aureus Mu3 FIG   Nitrate/nitrite transporter NarT
fig|505321.3.peg.174 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Nitrate/nitrite transporter NarT
fig|548473.3.peg.198 Staphylococcus aureus subsp. aureus TCH60 FIG   Nitrate/nitrite transporter NarT
fig|553565.3.peg.2014 Staphylococcus aureus A5937 FIG   Nitrate/nitrite transporter NarT
fig|553571.3.peg.1537 Staphylococcus aureus A6300 FIG   Nitrate/nitrite transporter NarT
fig|553573.3.peg.780 Staphylococcus aureus A8115 FIG   Nitrate/nitrite transporter NarT
fig|553574.3.peg.1177 Staphylococcus aureus A8117 FIG   Nitrate/nitrite transporter NarT
fig|553577.3.peg.216 Staphylococcus aureus A8796 FIG   Nitrate/nitrite transporter NarT
fig|553580.3.peg.218 Staphylococcus aureus A8819 FIG   Nitrate/nitrite transporter NarT
fig|553581.3.peg.2504 Staphylococcus aureus A9299 FIG   Nitrate/nitrite transporter NarT
fig|553583.3.peg.2619 Staphylococcus aureus A9635 FIG   Nitrate/nitrite transporter NarT
fig|553588.3.peg.2594 Staphylococcus aureus A9719 FIG   Nitrate/nitrite transporter NarT
fig|553592.3.peg.532 Staphylococcus aureus A9763 FIG   Nitrate/nitrite transporter NarT
fig|553596.3.peg.1636 Staphylococcus aureus A9781 FIG   Nitrate/nitrite transporter NarT
fig|585143.3.peg.866 Staphylococcus aureus subsp. aureus 55/2053 FIG   Nitrate/nitrite transporter NarT
fig|585144.3.peg.856 Staphylococcus aureus subsp. aureus 58-424 FIG   Nitrate/nitrite transporter NarT
fig|585145.3.peg.665 Staphylococcus aureus subsp. aureus 65-1322 FIG   Nitrate/nitrite transporter NarT
fig|585146.3.peg.296 Staphylococcus aureus subsp. aureus 68-397 FIG   Nitrate/nitrite transporter NarT
fig|585149.6.peg.2569 Staphylococcus aureus subsp. aureus C101 FIG   Nitrate/nitrite transporter NarT
fig|585151.3.peg.2377 Staphylococcus aureus subsp. aureus C427 FIG   Nitrate/nitrite transporter NarT
fig|585153.3.peg.664 Staphylococcus aureus subsp. aureus E1410 FIG   Nitrate/nitrite transporter NarT
fig|585156.3.peg.2068 Staphylococcus aureus subsp. aureus M1015 FIG   Nitrate/nitrite transporter NarT
fig|585157.3.peg.2064 Staphylococcus aureus subsp. aureus M809 FIG   Nitrate/nitrite transporter NarT
fig|585158.3.peg.443 Staphylococcus aureus subsp. aureus M876 FIG   Nitrate/nitrite transporter NarT
fig|585159.3.peg.2498 Staphylococcus aureus subsp. aureus M899 FIG   Nitrate/nitrite transporter NarT
fig|585160.3.peg.2207 Staphylococcus aureus subsp. aureus WBG10049 FIG   Nitrate/nitrite transporter NarT
fig|585891.3.peg.2466 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Nitrate/nitrite transporter NarT
fig|680649.3.peg.1346 Staphylococcus aureus subsp. aureus MR1 FIG   Nitrate/nitrite transporter NarT
fig|681288.4.peg.2415 Staphylococcus aureus subsp. aureus ED98 FIG   Nitrate/nitrite transporter NarT
fig|703339.3.peg.2376 Staphylococcus aureus 04-02981 FIG   Nitrate/nitrite transporter NarT
gb|ABQ50192.1 Staphylococcus aureus subsp. aureus JH9     major facilitator superfamily MFS_1
gb|ABR53284.1 Staphylococcus aureus subsp. aureus JH1     major facilitator superfamily MFS_1
gb|EEV04991.1 Staphylococcus aureus subsp. aureus 55/2053     nitrite extrusion protein
gb|EEV07636.1 Staphylococcus aureus subsp. aureus 65-1322     nitrite extrusion protein
gb|EEV10258.1 Staphylococcus aureus subsp. aureus 68-397     nitrate transporter narT
gb|EEV12847.1 Staphylococcus aureus subsp. aureus E1410     nitrite extrusion protein
gb|EEV15508.1 Staphylococcus aureus subsp. aureus M876     nitrite extrusion protein
gb|EEV27040.1 Staphylococcus aureus A9781     nitrate transporter NarT
gb|EEV65371.1 Staphylococcus aureus A9763     nitrate transporter narT
gb|EEV66132.1 Staphylococcus aureus A9719     nitrate transporter narT
gb|EEV68945.1 Staphylococcus aureus A9635     nitrite extrusion protein
gb|EEV71434.1 Staphylococcus aureus A9299     nitrite extrusion protein
gb|EEV75842.1 Staphylococcus aureus A8115     nitrite extrusion protein
gb|EEV77529.1 Staphylococcus aureus A6300     nitrite extrusion protein
gb|EEV85233.1 Staphylococcus aureus A5937     nitrite extrusion protein
gi|13702337 Staphylococcus aureus subsp. aureus N315 NCBI   nitrite extrusion protein
gi|14248162 Staphylococcus aureus subsp. aureus Mu50 NCBI   nitrite extrusion protein
gi|147741894 Staphylococcus aureus subsp. aureus JH9 NCBI   major facilitator superfamily MFS_1
gi|148268825 Staphylococcus aureus subsp. aureus JH9 NCBI   major facilitator transporter
gi|149947348 Staphylococcus aureus subsp. aureus JH1 NCBI   major facilitator superfamily MFS_1
gi|150394896 Staphylococcus aureus subsp. aureus JH1 NCBI   major facilitator transporter
gi|156722838 Staphylococcus aureus subsp. aureus Mu3 NCBI   nitrite extrusion protein
gi|156980703 Staphylococcus aureus subsp. aureus Mu3 NCBI   nitrite extrusion protein
gi|15925378 Staphylococcus aureus subsp. aureus Mu50 NCBI   nitrite extrusion protein
gi|15927966 Staphylococcus aureus subsp. aureus N315 NCBI   nitrite extrusion protein
gi|205829200 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable nitrate transporter narT
gi|205829201 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable nitrate transporter narT
gi|205829202 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable nitrate transporter narT
gi|253314725 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   nitrite extrusion protein
gi|255007162 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   nitrite extrusion protein
gi|257272889 Staphylococcus aureus subsp. aureus 55/2053 NCBI   nitrite extrusion protein
gi|257276185 Staphylococcus aureus subsp. aureus 65-1322 NCBI   nitrite extrusion protein
gi|257279671 Staphylococcus aureus subsp. aureus 68-397 NCBI   nitrate transporter narT
gi|257282715 Staphylococcus aureus subsp. aureus E1410 NCBI   nitrite extrusion protein
gi|257285392 Staphylococcus aureus subsp. aureus M876 NCBI   nitrite extrusion protein
gi|257423871 Staphylococcus aureus subsp. aureus 55/2053 NCBI   nitrite extrusion protein
gi|257426554 Staphylococcus aureus subsp. aureus 65-1322 NCBI   nitrite extrusion protein
gi|257429190 Staphylococcus aureus subsp. aureus 68-397 NCBI   nitrate transporter narT
gi|257431836 Staphylococcus aureus subsp. aureus E1410 NCBI   nitrite extrusion protein
gi|257434796 Staphylococcus aureus subsp. aureus M876 NCBI   nitrite extrusion protein
gi|257788700 Staphylococcus aureus A9781 NCBI   nitrate transporter NarT
gi|257794728 Staphylococcus aureus A9781 NCBI   nitrate transporter NarT
gi|257840920 Staphylococcus aureus A9763 NCBI   nitrate transporter narT
gi|257841695 Staphylococcus aureus A9719 NCBI   nitrate transporter narT
gi|257844902 Staphylococcus aureus A9635 NCBI   nitrite extrusion protein
gi|257847432 Staphylococcus aureus A9299 NCBI   nitrite extrusion protein
gi|257851908 Staphylococcus aureus A8115 NCBI   nitrite extrusion protein
gi|257854581 Staphylococcus aureus A6300 NCBI   nitrite extrusion protein
gi|257862465 Staphylococcus aureus A5937 NCBI   nitrite extrusion protein
gi|258407408 Staphylococcus aureus A9763 NCBI   nitrate transporter narT
gi|258422264 Staphylococcus aureus A9719 NCBI   nitrate transporter narT
gi|258425068 Staphylococcus aureus A9635 NCBI   nitrite extrusion protein
gi|258439656 Staphylococcus aureus A9299 NCBI   nitrite extrusion protein
gi|258442787 Staphylococcus aureus A8115 NCBI   nitrite extrusion protein
gi|258446513 Staphylococcus aureus A6300 NCBI   nitrite extrusion protein
gi|258455254 Staphylococcus aureus A5937 NCBI   nitrite extrusion protein
gi|81705145 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable nitrate transporter narT
gi|81781001 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable nitrate transporter narT
img|637093929 Staphylococcus aureus aureus N315 IMG   nitrite extrusion protein
img|637100945 Staphylococcus aureus aureus Mu50 IMG   nitrite extrusion protein
img|639109811 Staphylococcus aureus aureus JH1 IMG   Major facilitator superfamily MFS_1
img|640566800 Staphylococcus aureus aureus JH9 IMG   major facilitator superfamily MFS_1
img|640780571 Staphylococcus aureus aureus JH1 IMG   major facilitator superfamily MFS_1
img|640905170 Staphylococcus aureus aureus Mu3 IMG   nitrite extrusion protein
kegg|sah:SaurJH1_2459 Staphylococcus aureus subsp. aureus JH1 KEGG   major facilitator transporter
kegg|saj:SaurJH9_2412 Staphylococcus aureus subsp. aureus JH9 KEGG   major facilitator transporter
kegg|sau:SA2176   KEGG   nitrite extrusion protein
kegg|sav:SAV2388   KEGG   nitrite extrusion protein
kegg|saw:SAHV_2372 Staphylococcus aureus subsp. aureus Mu3 KEGG   nitrite extrusion protein
ref|NP_372912.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   nitrite extrusion protein
ref|NP_375499.1 Staphylococcus aureus subsp. aureus N315 RefSeq   nitrite extrusion protein
ref|YP_001247768.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   major facilitator transporter
ref|YP_001317571.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   major facilitator transporter
ref|YP_001442962.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   nitrite extrusion protein
ref|ZP_04837938.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   nitrite extrusion protein
ref|ZP_05145763.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   nitrite extrusion protein
ref|ZP_05600300.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   nitrite extrusion protein
ref|ZP_05602956.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   nitrite extrusion protein
ref|ZP_05605577.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   nitrate transporter narT
ref|ZP_05608199.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   nitrite extrusion protein
ref|ZP_05610847.1 Staphylococcus aureus subsp. aureus M876 RefSeq   nitrite extrusion protein
ref|ZP_05643707.1 Staphylococcus aureus A9781 RefSeq   nitrate transporter NarT
ref|ZP_05680551.1 Staphylococcus aureus A9763 RefSeq   nitrate transporter narT
ref|ZP_05685176.1 Staphylococcus aureus A9719 RefSeq   nitrate transporter narT
ref|ZP_05687939.1 Staphylococcus aureus A9635 RefSeq   nitrite extrusion protein
ref|ZP_05690402.1 Staphylococcus aureus A9299 RefSeq   nitrite extrusion protein
ref|ZP_05691347.1 Staphylococcus aureus A8115 RefSeq   nitrite extrusion protein
ref|ZP_05694668.1 Staphylococcus aureus A6300 RefSeq   nitrite extrusion protein
ref|ZP_05703214.1 Staphylococcus aureus A5937 RefSeq   nitrite extrusion protein
sp|A5IVG9 Staphylococcus aureus (strain JH9) SwissProt   Probable nitrate transporter narT
sp|A6U4B6 Staphylococcus aureus (strain JH1) SwissProt   Probable nitrate transporter narT
sp|A7X618 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Probable nitrate transporter narT
sp|NART_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable nitrate transporter narT
sp|NART_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable nitrate transporter narT
sp|NART_STAA9 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable nitrate transporter narT
sp|NART_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable nitrate transporter narT
sp|NART_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable nitrate transporter narT
sp|Q7A3U8 Staphylococcus aureus (strain N315) SwissProt   Probable nitrate transporter narT
sp|Q99RP1 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Probable nitrate transporter narT


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search