The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2234: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Transcriptional regulator, MarR family
Translate Function Assignments



Context on contig NC_002745 from base 2317872 to 2329484 (11613 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2230 2321039 2317872 3168 -       1: 5   RND multidrug efflux transporter; Acriflavin resistance protein locus|SA2056, protein_id|NP_375374.1, gi|15927841, geneID|1124979
2231 2322421 2321156 1266 - 116     1: 4 dlit(15280360) Lipid II:glycine glycyltransferase (EC 2.3.2.16) ## FemX gene_name|fmhB, locus|SA2057, protein_id|NP_375375.1, gi|15927842, geneID|1124980
2232 2322801 2323061 261 + 379         Hypothetical protein SAV2263 locus|SA2058, protein_id|NP_375376.1, gi|15927843, geneID|1124981
2233 2323817 2323053 765 - -9         Hypothetical protein SAV2264 locus|SA2059, protein_id|NP_375377.1, gi|15927844, geneID|1124982
2234 2323979 2324419 441 + 161     1: 3   Transcriptional regulator, MarR family locus|SA2060, protein_id|NP_375378.1, gi|15927845, geneID|1124983
2235 2324502 2325623 1122 + 82         Major facilitator family transporter locus|SA2061, protein_id|NP_375379.1, gi|15927846, geneID|1124984
2236 2326075 2325725 351 - 101       dlit(15292128) Transcriptional regulator SarV (Staphylococcal accessory regulator V) locus|SA2062, protein_id|NP_375380.1, gi|15927847, geneID|1124985
2237 2326548 2326429 120 - 353         FIG01108563: hypothetical protein  
2238 2327674 2326652 1023 - 103     1: 1 dlit(26575208)
dlit(25941396)
GTP 3',8-cyclase (EC 4.1.99.22) ## MoaA gene_name|moaA, locus|SA2063, protein_id|NP_375381.1, gi|15927848, geneID|1124986
2239 2328293 2327694 600 - 19     2: 2 1   Molybdenum cofactor guanylyltransferase (EC 2.7.7.77) gene_name|mobA, locus|SA2064, protein_id|NP_375382.1, gi|15927849, geneID|1124987
2240 2328533 2328300 234 - 6     2: 2 1   Molybdopterin synthase sulfur carrier subunit ## MoaD gene_name|moaD, locus|SA2065, protein_id|NP_375383.1, gi|15927850, geneID|1124988
2241 2328985 2328539 447 - 5     2: 2 1   Molybdopterin synthase catalytic subunit MoaE (EC 2.8.1.12) gene_name|moaE, locus|SA2066, protein_id|NP_375384.1, gi|15927851, geneID|1124989
2242 2329484 2328999 486 - 13     2: 2 1   Molybdopterin-guanine dinucleotide biosynthesis protein MobB gene_name|mobB, locus|SA2067, protein_id|NP_375385.1, gi|15927852, geneID|1124990

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Gra Transcriptional regulator, MarR family


  Protein Sequence

>fig|158879.11.peg.2234 Transcriptional regulator, MarR family
MLSQEFFNSFITIYRPYLKLAEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEK
PTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNI
SQDQMQETINVMNQIHEILLKEAHND

MD5 = 00ea5027d0b7e5ef621e21ce16aaa2a6


  DNA Sequence

>fig|158879.11.peg.2234 Transcriptional regulator, MarR family
atgctatcacaagaatttttcaatagttttataacaatatatcgcccctatttaaaatta
gcagagccgattttggaaaaacacaatatatattatggtcaatggttaatcttacgcgat
atcgctaaacatcagcccactactctcattgaaatttcacatagacgtgcaattgaaaag
cctactgcaagaaaaactttaaaagctctaatagaaaatgaccttataacagtagaaaac
agtttagaggataaacgacaaaagtttttaactttaacacctaaagggcatgaattatat
gagattgtttgtcttgatgtacaaaagctccaacaagcagtagttgccaaaacaaacatt
tcgcaagatcaaatgcaagaaaccataaatgtgatgaatcaaattcatgaaatattatta
aaggaggcacacaatgactaa


  DNA with Flanking Sequence

>fig|158879.11.peg.2234 Transcriptional regulator, MarR family
ccctactacttcaacctgctcactttgtagtttatttttaactgcctctatatcatttgt
acgcaaacaaatatttttaaagccttgctcatacttctcttgaacaatttgagtagcaaa
agcgactccaccttctatcgtttttgccatctttttcaacttttcattattttctacatc
cagtagctcaatataattttcattgatataacctaatttattgaatgttccatatttatg
atgatacccacctgaatgtaattttataacatctcctggaaaactaaaccgatctaactg
atctatataatgaatgatgtgatcaaatttcaatatcattagtatccccctatttacatg
taattacgcttattttaacaaagtataattatttttgctcttaataattatatattgatt
tctaattgctcccgttttataattactattgttgtaaaaaggttagctaagctaactatt
ttgtcttaggagatgtcactatgctatcacaagaatttttcaatagttttataacaatat
atcgcccctatttaaaattagcagagccgattttggaaaaacacaatatatattatggtc
aatggttaatcttacgcgatatcgctaaacatcagcccactactctcattgaaatttcac
atagacgtgcaattgaaaagcctactgcaagaaaaactttaaaagctctaatagaaaatg
accttataacagtagaaaacagtttagaggataaacgacaaaagtttttaactttaacac
ctaaagggcatgaattatatgagattgtttgtcttgatgtacaaaagctccaacaagcag
tagttgccaaaacaaacatttcgcaagatcaaatgcaagaaaccataaatgtgatgaatc
aaattcatgaaatattattaaaggaggcacacaatgactaatcaaggctcattaaataaa
tcacctattttcaccaaaagttttacaatcaacttttttgtcaactttatcgtataccta
tgcatgtatttgttacttgtagttattgctggctatagtaagcaagctttcgacgcttcc
gattcattagccggattagttgtaggactatttattgtcgggtctttaattggtcgattt
gctacaggtaaatttgtaaatcaaatcggacctaaacgattattatttattggtttaatt
gctttaattatcacgcaattactttattttattgatggatctttagcttttttaatcttt
gtacgtctcataaacggtatcgcaactgcagttgtgacaactgcaacaggtactattgcg
gcatacgttacccctgttaatagaaaaagtgaaggcatcagtttattttccttaagttta
gtattaggtacagcgattggcccatttctaggcatgttacttattacaaaatacgcaatt
g


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003700       F:transcription factor activity
GO:0005622       C:intracellular
GO:0006350       P:transcription
GO:0006355       P:regulation of transcription, DNA-dependent
cmr|NT01SA2275 Staphylococcus aureus N315     transcriptional regulator, MarR family family
cmr|NT02SA2268 Staphylococcus aureus Mu50     transcription regulator MarR family
cmr|NT05SA2279 Staphylococcus aureus NCTC 8325     transcriptional regulator, MarR family
cmr|SACOL2256 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, MarR family
dbj|BAB43357.1 Staphylococcus aureus subsp. aureus N315     SA2060
dbj|BAB58427.1 Staphylococcus aureus subsp. aureus Mu50     similar to transcription regulator MarR family
dbj|BAF68437.1 Staphylococcus aureus subsp. aureus str. Newman     MarR family regulatory protein
dbj|BAF79132.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2265 Staphylococcus aureus subsp. aureus Mu50 FIG   Transcriptional regulator, MarR family
fig|158878.14.peg.2343 Staphylococcus aureus subsp. aureus Mu50 FIG   Transcriptional regulator, MarR family
fig|158879.1.peg.2140 Staphylococcus aureus subsp. aureus N315 FIG   Transcriptional regulator, MarR family
fig|359786.13.peg.2423 Staphylococcus aureus subsp. aureus JH9 FIG   Transcriptional regulator, MarR family
fig|359786.3.peg.2279 Staphylococcus aureus subsp. aureus JH9 FIG   Transcriptional regulator, MarR family
fig|359787.11.peg.2385 Staphylococcus aureus subsp. aureus JH1 FIG   Transcriptional regulator, MarR family
fig|359787.3.peg.2121 Staphylococcus aureus subsp. aureus JH1 FIG   Transcriptional regulator, MarR family
fig|418127.6.peg.2307 Staphylococcus aureus subsp. aureus Mu3 FIG   Transcriptional regulator, MarR family
fig|426430.8.peg.2354 Staphylococcus aureus subsp. aureus str. Newman FIG   Transcriptional regulator, MarR family
fig|450394.6.peg.1475 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Transcriptional regulator, MarR family
fig|452948.4.peg.1156 Staphylococcus aureus 930918-3 FIG   Transcriptional regulator, MarR family
fig|455227.3.peg.484 Staphylococcus aureus D30 FIG   Transcriptional regulator, MarR family
fig|505321.3.peg.45 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Transcriptional regulator, MarR family
fig|546342.3.peg.2009 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Transcriptional regulator, MarR family
fig|546343.3.peg.139 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Transcriptional regulator, MarR family
fig|553565.3.peg.2142 Staphylococcus aureus A5937 FIG   Transcriptional regulator, MarR family
fig|553567.3.peg.232 Staphylococcus aureus A5948 FIG   Transcriptional regulator, MarR family
fig|553568.3.peg.2592 Staphylococcus aureus A6224 FIG   Transcriptional regulator, MarR family
fig|553571.3.peg.1666 Staphylococcus aureus A6300 FIG   Transcriptional regulator, MarR family
fig|553573.3.peg.653 Staphylococcus aureus A8115 FIG   Transcriptional regulator, MarR family
fig|553574.3.peg.1050 Staphylococcus aureus A8117 FIG   Transcriptional regulator, MarR family
fig|553580.3.peg.91 Staphylococcus aureus A8819 FIG   Transcriptional regulator, MarR family
fig|553581.3.peg.2632 Staphylococcus aureus A9299 FIG   Transcriptional regulator, MarR family
fig|553588.3.peg.2721 Staphylococcus aureus A9719 FIG   Transcriptional regulator, MarR family
fig|553592.3.peg.1081 Staphylococcus aureus A9763 FIG   Transcriptional regulator, MarR family
fig|553594.3.peg.1145 Staphylococcus aureus A9765 FIG   Transcriptional regulator, MarR family
fig|553596.3.peg.1508 Staphylococcus aureus A9781 FIG   Transcriptional regulator, MarR family
fig|553601.3.peg.491 Staphylococcus aureus A10102 FIG   Transcriptional regulator, MarR family
fig|585152.3.peg.2234 Staphylococcus aureus subsp. aureus D139 FIG   Transcriptional regulator, MarR family
fig|585155.3.peg.802 Staphylococcus aureus subsp. aureus H19 FIG   Transcriptional regulator, MarR family
fig|585891.3.peg.2339 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Transcriptional regulator, MarR family
fig|644279.4.peg.2401 Staphylococcus aureus subsp. aureus 132 FIG   Transcriptional regulator, MarR family
fig|680649.3.peg.2149 Staphylococcus aureus subsp. aureus MR1 FIG   Transcriptional regulator, MarR family
fig|681288.4.peg.2287 Staphylococcus aureus subsp. aureus ED98 FIG   Transcriptional regulator, MarR family
fig|703339.3.peg.2249 Staphylococcus aureus 04-02981 FIG   Transcriptional regulator, MarR family
fig|93061.3.peg.2386 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transcriptional regulator, MarR family
fig|93061.5.peg.2282 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Transcriptional regulator, MarR family
fig|93062.19.peg.2198 Staphylococcus aureus subsp. aureus COL FIG   Transcriptional regulator, MarR family
fig|93062.4.peg.2308 Staphylococcus aureus subsp. aureus COL FIG   Transcriptional regulator, MarR family
gb|AAW37128.1 Staphylococcus aureus subsp. aureus COL     transcriptional regulator, MarR family
gb|ABD31545.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ50070.1 Staphylococcus aureus subsp. aureus JH9     transcriptional regulator, MarR family
gb|ABR53157.1 Staphylococcus aureus subsp. aureus JH1     regulatory protein MarR
gb|EES95106.1 Staphylococcus aureus subsp. aureus USA300_TCH959     MarR family transcriptional regulator
gb|EEV26921.1 Staphylococcus aureus A9781     transcriptional regulator
gb|EEV64931.1 Staphylococcus aureus A9763     transcriptional regulator
gb|EEV66254.1 Staphylococcus aureus A9719     MarR family transcriptional regulator
gb|EEV71554.1 Staphylococcus aureus A9299     transcriptional regulator
gb|EEV75723.1 Staphylococcus aureus A8115     regulatory protein MarR
gb|EEV77649.1 Staphylococcus aureus A6300     MarR family transcriptional regulator
gb|EEV79250.1 Staphylococcus aureus A6224     transcriptional regulator
gb|EEV84326.1 Staphylococcus aureus A5948     regulatory protein MarR
gb|EEV85358.1 Staphylococcus aureus A5937     MarR family transcription regulator
gb|EEW45097.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0580
gb|EEW47942.1 Staphylococcus aureus D30     hypothetical protein SAD30_0065
gi|13702065 Staphylococcus aureus subsp. aureus N315 NCBI   SA2060
gi|14248038 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to transcription regulator MarR family
gi|147741772 Staphylococcus aureus subsp. aureus JH9 NCBI   transcriptional regulator, MarR family
gi|148268703 Staphylococcus aureus subsp. aureus JH9 NCBI   MarR family transcriptional regulator
gi|149947221 Staphylococcus aureus subsp. aureus JH1 NCBI   regulatory protein MarR
gi|150375177 Staphylococcus aureus subsp. aureus str. Newman NCBI   MarR family regulatory protein
gi|150394769 Staphylococcus aureus subsp. aureus JH1 NCBI   regulatory protein MarR
gi|151222377 Staphylococcus aureus subsp. aureus str. Newman NCBI   MarR family regulatory protein
gi|156722715 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980580 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2249
gi|15925255 Staphylococcus aureus subsp. aureus Mu50 NCBI   MarR family transcription regulator
gi|15927845 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA2060
gi|221138965 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   hypothetical protein SauraJK_10050
gi|221140135 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   hypothetical protein SauraJ_00699
gi|253314606 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_00235
gi|253726377 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   MarR family transcriptional regulator
gi|253729930 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   MarR family transcriptional regulator
gi|255007043 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_11260
gi|257788581 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257794609 Staphylococcus aureus A9781 NCBI   transcriptional regulator
gi|257840471 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|257841817 Staphylococcus aureus A9719 NCBI   MarR family transcriptional regulator
gi|257847552 Staphylococcus aureus A9299 NCBI   transcriptional regulator
gi|257851789 Staphylococcus aureus A8115 NCBI   regulatory protein MarR
gi|257854701 Staphylococcus aureus A6300 NCBI   MarR family transcriptional regulator
gi|257856341 Staphylococcus aureus A6224 NCBI   transcriptional regulator
gi|257861524 Staphylococcus aureus A5948 NCBI   regulatory protein MarR
gi|257862590 Staphylococcus aureus A5937 NCBI   MarR family transcription regulator
gi|258408788 Staphylococcus aureus A9763 NCBI   transcriptional regulator
gi|258422386 Staphylococcus aureus A9719 NCBI   MarR family transcriptional regulator
gi|258439776 Staphylococcus aureus A9299 NCBI   transcriptional regulator
gi|258442668 Staphylococcus aureus A8115 NCBI   regulatory protein MarR
gi|258446633 Staphylococcus aureus A6300 NCBI   MarR family transcriptional regulator
gi|258450249 Staphylococcus aureus A6224 NCBI   transcriptional regulator
gi|258450741 Staphylococcus aureus A5948 NCBI   regulatory protein MarR
gi|258455379 Staphylococcus aureus A5937 NCBI   MarR family transcription regulator
gi|259160064 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0580
gi|259163384 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_0065
gi|49036517 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized HTH-type transcriptional regulator SA2060
gi|49037277 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized HTH-type transcriptional regulator SAV2265
gi|57285034 Staphylococcus aureus subsp. aureus COL NCBI   transcriptional regulator, MarR family
gi|57650848 Staphylococcus aureus subsp. aureus COL NCBI   MarR family transcriptional regulator
gi|81693947 organism not parsed/found in ncbi nr NCBI   RecName: Full=Uncharacterized HTH-type transcriptional regulator SACOL2256
gi|87203735 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88196177 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_02530
img|637093808 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100822 Staphylococcus aureus aureus Mu50 IMG   similar to transcription regulator MarR family
img|637153016 Staphylococcus aureus aureus COL IMG   transcriptional regulator, MarR family
img|637895143 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639109263 Staphylococcus aureus aureus JH1 IMG   regulatory protein, MarR
img|640566678 Staphylococcus aureus aureus JH9 IMG   transcriptional regulator, MarR family
img|640780444 Staphylococcus aureus aureus JH1 IMG   regulatory protein MarR
img|640796596 Staphylococcus aureus aureus Newman IMG   MarR family regulatory protein
img|640905047 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641772621 Staphylococcus aureus aureus USA300_TCH959 IMG   MarR family transcriptional regulator
kegg|sac:SACOL2256 Staphylococcus aureus subsp. aureus COL KEGG   MarR family transcriptional regulator
kegg|sae:NWMN_2165 Staphylococcus aureus subsp. aureus Newman KEGG   MarR family regulatory protein
kegg|sah:SaurJH1_2332 Staphylococcus aureus subsp. aureus JH1 KEGG   regulatory protein MarR
kegg|saj:SaurJH9_2290 Staphylococcus aureus subsp. aureus JH9 KEGG   MarR family transcriptional regulator
kegg|sao:SAOUHSC_02530 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sau:SA2060   KEGG   hypothetical protein
kegg|sav:SAV2265   KEGG   MarR family transcription regulator
kegg|saw:SAHV_2249 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372789.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   MarR family transcription regulator
ref|NP_375378.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA2060
ref|YP_001247646.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   MarR family transcriptional regulator
ref|YP_001317444.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   regulatory protein MarR
ref|YP_001333199.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   MarR family regulatory protein
ref|YP_001442839.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2249
ref|YP_187063.1 Staphylococcus aureus subsp. aureus COL RefSeq   MarR family transcriptional regulator
ref|YP_500994.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_02530
ref|ZP_03563766.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   hypothetical protein SauraJK_10050
ref|ZP_03564628.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   hypothetical protein SauraJ_00699
ref|ZP_04837819.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_00235
ref|ZP_04864095.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   MarR family transcriptional regulator
ref|ZP_05145644.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_11260
ref|ZP_05643588.1 Staphylococcus aureus A9781 RefSeq   transcriptional regulator
ref|ZP_05681072.1 Staphylococcus aureus A9763 RefSeq   transcriptional regulator
ref|ZP_05685298.1 Staphylococcus aureus A9719 RefSeq   MarR family transcriptional regulator
ref|ZP_05690522.1 Staphylococcus aureus A9299 RefSeq   transcriptional regulator
ref|ZP_05691228.1 Staphylococcus aureus A8115 RefSeq   regulatory protein MarR
ref|ZP_05694788.1 Staphylococcus aureus A6300 RefSeq   MarR family transcriptional regulator
ref|ZP_05698341.1 Staphylococcus aureus A6224 RefSeq   transcriptional regulator
ref|ZP_05698800.1 Staphylococcus aureus A5948 RefSeq   regulatory protein MarR
ref|ZP_05703339.1 Staphylococcus aureus A5937 RefSeq   MarR family transcription regulator
sp|P62086 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=Uncharacterized HTH-type transcriptional regulator SAV2265
sp|P62087 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=Uncharacterized HTH-type transcriptional regulator SA2060
sp|Q5HDU4 Staphylococcus aureus (strain COL) SwissProt   RecName: Full=Uncharacterized HTH-type transcriptional regulator SACOL2256
sp|Y2060_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized HTH-type transcriptional regulator SA2060
sp|Y2256_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized HTH-type transcriptional regulator SACOL2256
sp|Y2265_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Uncharacterized HTH-type transcriptional regulator SAV2265
tr|A5IV47 Staphylococcus aureus (strain JH9) TrEMBL   Transcriptional regulator, MarR family
tr|A6QJA5 Staphylococcus aureus (strain Newman) TrEMBL   MarR family regulatory protein
tr|A6U3Y9 Staphylococcus aureus (strain JH1) TrEMBL   Regulatory protein MarR
tr|A7X5I6 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C5MZF3 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   MarR family transcriptional regulator
tr|Q2FVZ1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search