The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2057: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
Translate Function Assignments



Context on contig NC_002745 from base 2147041 to 2159438 (12398 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2049 2147682 2147041 642 -       4: 3 5 1 4   Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3) gene_name|thiE, locus|SA1894, protein_id|NP_375199.1, gi|15927666, geneID|1124795
2050 2148475 2147684 792 - 1     3: 3 1 4   Hydroxyethylthiazole kinase (EC 2.7.1.50) gene_name|thiM, locus|SA1895, protein_id|NP_375200.1, gi|15927667, geneID|1124796
2051 2149289 2148459 831 - -17     4: 3 5 1 4   Hydroxymethylpyrimidine kinase (EC 2.7.1.49) @ Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7) gene_name|thiD, locus|SA1896, protein_id|NP_375201.1, gi|15927668, geneID|1124797
2052 2149971 2149282 690 - -8     1: 1   Thiaminase II (EC 3.5.99.2) involved in salvage of thiamin pyrimidine moiety locus|SA1897, protein_id|NP_375202.1, gi|15927669, geneID|1124798
2053 2150196 2150071 126 - 99         FIG01107883: hypothetical protein  
2054 2151053 2150358 696 - 161       dlit(17997515) SceD-like transglycosylase, biomarker for vancomycin-intermediate strains locus|SA1898, protein_id|NP_375203.1, gi|15927670, geneID|1124799
2055 2151837 2151442 396 - 388 4 3: 10 11 9   Single-stranded DNA-binding protein locus|SA1899, protein_id|NP_375204.1, gi|15927671, geneID|1124800
2056 2152031 2152471 441 + 193         Hypothetical protein SAV2097 locus|SA1900, protein_id|NP_375205.1, gi|15927672, geneID|1124801
2057 2152970 2152530 441 - 58   2: 6 13   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59) gene_name|fabZ, locus|SA1901, protein_id|NP_375206.1, gi|15927673, geneID|1124802
2058 2154269 2153004 1266 - 33     2: 7 12   UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) gene_name|murA, locus|SA1902, protein_id|NP_375207.1, gi|15927674, geneID|1124803
2059 2154613 2154380 234 - 110         Uncharacterized membrane protein YwzB locus|SA1903, protein_id|NP_375208.1, gi|15927675, geneID|1124804
2060 2155579 2155175 405 - 561     1: 2   ATP synthase epsilon chain (EC 7.1.2.2) gene_name|atpC, locus|SA1904, protein_id|NP_375209.1, gi|15927676, geneID|1124805
2061 2157011 2155599 1413 - 19     2: 8 2   ATP synthase beta chain (EC 7.1.2.2) gene_name|atpD, locus|SA1905, protein_id|NP_375210.1, gi|15927677, geneID|1124806
2062 2157899 2157033 867 - 21     1: 2   ATP synthase gamma chain (EC 7.1.2.2) gene_name|atpG, locus|SA1906, protein_id|NP_375211.1, gi|15927678, geneID|1124807
2063 2159438 2157930 1509 - 30     1: 2   ATP synthase alpha chain (EC 7.1.2.2) gene_name|atpA, locus|SA1907, protein_id|NP_375212.1, gi|15927679, geneID|1124808

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
DUF89CLO 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
Fatty_Acid_Biosynthesis_FASII AndreiO 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)


  Protein Sequence

>fig|158879.11.peg.2057 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
METIFDYNQIKQIIPHRQPFLLIDKVVEYEEGQRCVAIKQVSGNEPFFQGHFPEYAVMPG
VLITEALAQTGAVAILNSEENKGKIALFAGIDKCRFKRQVVPGDTLTLEVEITKIKGPIG
KGNAKATVDGQLACSCELTFAIQDVK

MD5 = 2b3b2e3d3e9721a2f4a430ff55b65aed


  DNA Sequence

>fig|158879.11.peg.2057 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
atggaaacaatttttgattataaccaaattaaacaaattatacctcacagacagccattt
ttattaattgataaagtagttgaatatgaagaaggtcaacgttgtgtggctattaaacaa
gtatcaggaaacgaaccattctttcaagggcattttcctgagtatgcggtaatgccaggc
gtattaattactgaagcgttagctcaaacaggtgcggtagctattttaaatagtgaagaa
aataaaggtaaaatcgctttatttgctggtattgataaatgtcgttttaaacgtcaagta
gtacctggtgatactttaacgttggaagtagaaatcactaaaattaaaggaccaatcggt
aaaggtaatgctaaagctactgtcgatggtcaacttgcttgtagttgtgaacttacattt
gcaattcaagatgtaaaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.2057 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
tctataaactagaagaaatgggcgttgaattggactatcaagaagatggtattcgtgtac
gtgctgaaggggaattacaacctgtagacatcaaaacactaccacatcctggattcccga
ctgatatgcaatcacaaatgatggcattgttattaacggcaaatggtcataaagtcgtaa
ccgaaactgtttttgaaaaccgttttatgcatgttgcagagttcaaacgtatgaatgcta
atatcaatgtagaaggtcgtagtgctaaacttgaaggtaaaagtcaattgcaaggtgcac
aagttaaagcgactgatttaagagcagcagcagccttaattttagctggattagttgctg
atggtaaaacaagcgttactgaattaacgcacctagatagaggctatgttgacttacacg
gtaaattgaagcaattaggtgcagacattgaacgtattaacgattaattcagtaaattaa
tataatggaggatttcaaccatggaaacaatttttgattataaccaaattaaacaaatta
tacctcacagacagccatttttattaattgataaagtagttgaatatgaagaaggtcaac
gttgtgtggctattaaacaagtatcaggaaacgaaccattctttcaagggcattttcctg
agtatgcggtaatgccaggcgtattaattactgaagcgttagctcaaacaggtgcggtag
ctattttaaatagtgaagaaaataaaggtaaaatcgctttatttgctggtattgataaat
gtcgttttaaacgtcaagtagtacctggtgatactttaacgttggaagtagaaatcacta
aaattaaaggaccaatcggtaaaggtaatgctaaagctactgtcgatggtcaacttgctt
gtagttgtgaacttacatttgcaattcaagatgtaaaataaaacaaaaaaaacattcaaa
gatttaatgtgttggcataatctttgaatgttttttattttactcttctaatttttcatc
ctttaactttggtttagactgcatcattcgattaaatgatttttttaattcttcaccaga
taatccatcatcaataagttgttctaataaactttcagcatactgttgacgtaaagtgta
aatatgacattcaaatacgatagacattgttgttttaaaatttttaatacttttcacagt
agattcaaataaagctggatcattggctggacgcgtgatgacgacacgaatatccaataa
ctgttcattgtcttgatattccttaaatgtttcataatgctcattagaaatgacaatttc
aagcaaccaacccgtgccactttcctctttattaattattacgccatcttctaattcata
ttctataattctgccgtgttcattcacaatttgaaaccttactgctttaaaagttttcat
a


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005737       C:cytoplasm
GO:0006633       P:fatty acid biosynthetic process
GO:0009245       P:lipid A biosynthetic process
GO:0016836       F:hydro-lyase activity
cmr|NT01SA2092 Staphylococcus aureus N315     beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ
cmr|NT02SA2103 Staphylococcus aureus Mu50     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
cmr|NT03SA2191 Staphylococcus aureus MW2     (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
cmr|NT05SA2107 Staphylococcus aureus NCTC 8325     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
cmr|NT08SA2153 Staphylococcus aureus subsp. aureus MRSA252     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
cmr|NT09SA2015 Staphylococcus aureus subsp. aureus MSSA476     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
cmr|NT11SA1991 Staphylococcus aureus RF122     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
cmr|SACOL2091 Staphylococcus aureus subsp. aureus COL     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
cmr|SAUSA300_2054 Staphylococcus aureus subsp. aureus USA300-FPR3757     (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
dbj|BAB43185.1 Staphylococcus aureus subsp. aureus N315     -hydroxymyristoyl- dehydratase
dbj|BAB58260.1 acyl carrier protein     #3R-hydroxymyristoyl-
dbj|BAB95888.1 acyl carrier protein     (3R)-hydroxymyristoyl-
dbj|BAF68275.1 Staphylococcus aureus subsp. aureus str. Newman     hydroxymyristoyl-(acyl carrier protein) dehydratase
dbj|BAF78966.1 acyl carrier protein     #3R-hydroxymyristoyl-
emb|CAG41168.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
emb|CAG43810.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
emb|CAI81672.1 Staphylococcus aureus RF122 EMBL   3R-hydroxymyristoyl ACP dehydratase
fig|158878.1.peg.2098 Staphylococcus aureus subsp. aureus Mu50 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|158878.14.peg.2173 Staphylococcus aureus subsp. aureus Mu50 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|158879.1.peg.1968 Staphylococcus aureus subsp. aureus N315 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|196620.1.peg.2023 Staphylococcus aureus subsp. aureus MW2 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|196620.5.peg.2098 Staphylococcus aureus subsp. aureus MW2 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|273036.3.peg.1922 Staphylococcus aureus RF122 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|273036.6.peg.2090 Staphylococcus aureus RF122 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|282458.1.peg.2064 Staphylococcus aureus subsp. aureus MRSA252 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|282458.4.peg.2193 Staphylococcus aureus subsp. aureus MRSA252 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|282459.1.peg.1979 Staphylococcus aureus subsp. aureus MSSA476 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|282459.5.peg.2084 Staphylococcus aureus subsp. aureus MSSA476 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|359786.13.peg.2252 Staphylococcus aureus subsp. aureus JH9 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|359786.3.peg.612 Staphylococcus aureus subsp. aureus JH9 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|359787.11.peg.2220 Staphylococcus aureus subsp. aureus JH1 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|359787.3.peg.309 Staphylococcus aureus subsp. aureus JH1 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|367830.3.peg.490 Staphylococcus aureus subsp. aureus USA300 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|418127.4.peg.1934 Staphylococcus aureus subsp. aureus Mu3 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|418127.6.peg.2141 Staphylococcus aureus subsp. aureus Mu3 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|426430.6.peg.1949 Staphylococcus aureus subsp. aureus str. Newman FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|426430.8.peg.2189 Staphylococcus aureus subsp. aureus str. Newman FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|450394.6.peg.2614 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|451515.3.peg.2193 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|451516.9.peg.2182 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|452948.4.peg.1689 Staphylococcus aureus 930918-3 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|455227.3.peg.1280 Staphylococcus aureus D30 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|546342.3.peg.39 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|546343.3.peg.1658 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|548470.3.peg.2243 Staphylococcus aureus subsp. aureus MN8 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|548473.3.peg.2469 Staphylococcus aureus subsp. aureus TCH60 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|548474.3.peg.1930 Staphylococcus aureus subsp. aureus TCH130 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|548475.3.peg.2613 Staphylococcus aureus subsp. aureus TCH70 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553565.3.peg.130 Staphylococcus aureus A5937 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553568.3.peg.2481 Staphylococcus aureus A6224 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553571.3.peg.715 Staphylococcus aureus A6300 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553573.3.peg.39 Staphylococcus aureus A8115 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553574.3.peg.2062 Staphylococcus aureus A8117 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553577.3.peg.2086 Staphylococcus aureus A8796 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553580.3.peg.2173 Staphylococcus aureus A8819 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553581.3.peg.687 Staphylococcus aureus A9299 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553583.3.peg.418 Staphylococcus aureus A9635 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553588.3.peg.2383 Staphylococcus aureus A9719 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553590.4.peg.2127 Staphylococcus aureus A9754 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553592.3.peg.150 Staphylococcus aureus A9763 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553594.3.peg.1453 Staphylococcus aureus A9765 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553596.3.peg.725 Staphylococcus aureus A9781 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|553601.3.peg.2392 Staphylococcus aureus A10102 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585143.3.peg.2650 Staphylococcus aureus subsp. aureus 55/2053 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585144.3.peg.2667 Staphylococcus aureus subsp. aureus 58-424 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585145.3.peg.2648 Staphylococcus aureus subsp. aureus 65-1322 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585146.3.peg.2628 Staphylococcus aureus subsp. aureus 68-397 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585147.3.peg.1650 Staphylococcus aureus subsp. aureus A017934/97 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585148.3.peg.1638 Staphylococcus aureus subsp. aureus Btn1260 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585149.6.peg.2268 Staphylococcus aureus subsp. aureus C101 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585150.3.peg.2724 Staphylococcus aureus subsp. aureus C160 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585151.3.peg.1810 Staphylococcus aureus subsp. aureus C427 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585152.3.peg.2073 Staphylococcus aureus subsp. aureus D139 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585153.3.peg.2715 Staphylococcus aureus subsp. aureus E1410 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585154.3.peg.2151 Staphylococcus aureus subsp. aureus EMRSA16 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585156.3.peg.1647 Staphylococcus aureus subsp. aureus M1015 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585157.3.peg.1762 Staphylococcus aureus subsp. aureus M809 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585158.3.peg.2634 Staphylococcus aureus subsp. aureus M876 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585159.3.peg.2196 Staphylococcus aureus subsp. aureus M899 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585160.3.peg.1582 Staphylococcus aureus subsp. aureus WBG10049 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585161.3.peg.1925 Staphylococcus aureus subsp. aureus WW2703/97 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|585891.3.peg.2170 Staphylococcus aureus subsp. aureus Mu50-omega FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|644279.4.peg.2241 Staphylococcus aureus subsp. aureus 132 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|680649.3.peg.2259 Staphylococcus aureus subsp. aureus MR1 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|681288.4.peg.2118 Staphylococcus aureus subsp. aureus ED98 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|703339.3.peg.2079 Staphylococcus aureus 04-02981 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|762962.3.peg.2408 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|93061.3.peg.2207 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|93061.5.peg.2117 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|93062.19.peg.2036 Staphylococcus aureus subsp. aureus COL FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
fig|93062.4.peg.2069 Staphylococcus aureus subsp. aureus COL FIG   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59)
gb|AAW37052.1 Staphylococcus aureus subsp. aureus COL     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|ABD21749.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|ABD31370.1 Staphylococcus aureus subsp. aureus NCTC 8325     beta-hydroxyacyl-ACP dehydratase, putative
gb|ABQ49917.1 acyl-carrier-protein     3-hydroxyacyl-
gb|ABR53002.1 Staphylococcus aureus subsp. aureus JH1     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|ABX30086.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|EEI94580.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|EEJ61992.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|EES56839.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|EES93919.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|EES97704.1 acyl carrier protein     (3R)-hydroxymyristoyl-
gb|EEV03116.1 Staphylococcus aureus subsp. aureus 55/2053     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|EEV05755.1 Staphylococcus aureus subsp. aureus 65-1322     hydroxymyristoyl-(acyl carrier protein) dehydratase
gb|EEV08416.1 acyl carrier protein     3R-hydroxymyristoyl-
gb|EEV10998.1 Staphylococcus aureus subsp. aureus E1410     hydroxymyristoyl
gb|EEV13647.1 Staphylococcus aureus subsp. aureus M876     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|EEV26169.1 Staphylococcus aureus A9781     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|EEV65802.1 Staphylococcus aureus A9763     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|EEV66379.1 acyl carrier protein     3R-hydroxymyristoyl-
gb|EEV70939.1 acyl carrier protein     3R-hydroxymyristoyl-
gb|EEV73294.1 Staphylococcus aureus A9299     hydroxymyristoyl
gb|EEV76466.1 acyl carrier protein     3R-hydroxymyristoyl-
gb|EEV78463.1 Staphylococcus aureus A6300     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|EEV79521.1 Staphylococcus aureus A6224     hydroxymyristoyl-(acyl carrier protein) dehydratase
gb|EEV87131.1 Staphylococcus aureus A5937     beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gb|EEW44672.1 Staphylococcus aureus 930918-3     3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
gb|EEW47198.1 Staphylococcus aureus D30     3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
gi|109828984 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|122538959 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|13701893 Staphylococcus aureus subsp. aureus N315 NCBI   -hydroxymyristoyl- dehydratase
gi|14247871 acyl carrier protein NCBI   #3R-hydroxymyristoyl-
gi|147741619 acyl-carrier-protein NCBI   3-hydroxyacyl-
gi|148268550 Staphylococcus aureus subsp. aureus JH9 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|149947066 Staphylococcus aureus subsp. aureus JH1 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|150375015 Staphylococcus aureus subsp. aureus str. Newman NCBI   hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|150394614 Staphylococcus aureus subsp. aureus JH1 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|151222215 Staphylococcus aureus subsp. aureus str. Newman NCBI   (3R)-hydroxymyristoyl-ACP dehydratase
gi|156722549 acyl carrier protein NCBI   #3R-hydroxymyristoyl-
gi|156980414 Staphylococcus aureus subsp. aureus Mu3 NCBI   (3R)-hydroxymyristoyl-ACP dehydratase
gi|15925088 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|15927673 Staphylococcus aureus subsp. aureus N315 NCBI   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
gi|160369115 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|161510306 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|166233440 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|172048983 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|189044403 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|189044404 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|189044405 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|21205194 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|21283752 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|221137053 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|221141618 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|227244821 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|227558816 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|227852194 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|227899560 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|251804182 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|251812330 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|253725190 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|253728975 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|253731063 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|253733067 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|255006887 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   (3R)-hydroxymyristoyl-ACP dehydratase
gi|257270943 Staphylococcus aureus subsp. aureus 55/2053 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257274238 Staphylococcus aureus subsp. aureus 65-1322 NCBI   hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|257277746 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|257280853 Staphylococcus aureus subsp. aureus E1410 NCBI   hydroxymyristoyl
gi|257283520 Staphylococcus aureus subsp. aureus M876 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257426238 Staphylococcus aureus subsp. aureus 55/2053 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257428896 Staphylococcus aureus subsp. aureus 65-1322 NCBI   hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|257431505 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|257434214 Staphylococcus aureus subsp. aureus E1410 NCBI   hydroxymyristoyl
gi|257437127 Staphylococcus aureus subsp. aureus M876 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257787829 Staphylococcus aureus A9781 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257793857 Staphylococcus aureus A9781 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257841358 Staphylococcus aureus A9763 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257841947 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|257846925 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|257849315 Staphylococcus aureus A9299 NCBI   hydroxymyristoyl
gi|257852548 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|257855526 Staphylococcus aureus A6300 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|257856615 Staphylococcus aureus A6224 NCBI   hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|257864385 Staphylococcus aureus A5937 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|258407025 Staphylococcus aureus A9763 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|258422047 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|258422901 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|258433584 Staphylococcus aureus A9299 NCBI   hydroxymyristoyl
gi|258440479 acyl carrier protein NCBI   3R-hydroxymyristoyl-
gi|258445687 Staphylococcus aureus A6300 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|258450141 Staphylococcus aureus A6224 NCBI   hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|258453404 Staphylococcus aureus A5937 NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|259159626 Staphylococcus aureus 930918-3 NCBI   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
gi|259162631 Staphylococcus aureus D30 NCBI   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
gi|49242452 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|49245335 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|49484323 Staphylococcus aureus subsp. aureus MRSA252 NCBI   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|49486892 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
gi|54037095 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|54037096 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|54040990 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|56748956 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|56749010 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|57284958 Staphylococcus aureus subsp. aureus COL NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|57650772 Staphylococcus aureus subsp. aureus COL NCBI   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
gi|62286698 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
gi|82657231 Staphylococcus aureus RF122 NCBI   3R-hydroxymyristoyl ACP dehydratase
gi|82751700 Staphylococcus aureus RF122 NCBI   3R-hydroxymyristoyl ACP dehydratase
gi|87127235 acyl carrier protein NCBI   (3R)-hydroxymyristoyl-
gi|87161261 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   (3R)-hydroxymyristoyl-ACP dehydratase
gi|87203560 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   beta-hydroxyacyl-ACP dehydratase, putative
gi|88196002 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   beta-hydroxyacyl-ACP dehydratase, putative
gi|91206652 acyl-carrier-protein NCBI   RecName: Full=(3R)-hydroxymyristoyl-
img|637093627 Staphylococcus aureus aureus N315 IMG   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
img|637100647 Staphylococcus aureus aureus Mu50 IMG   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
img|637152850 Staphylococcus aureus aureus COL IMG   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ( EC:4.2.1.- )
img|637155616 Staphylococcus aureus aureus MRSA252 IMG   putative hydroxymyristoyl-(acyl carrier protein) dehydratase( EC:4.2.1.- )
img|637158261 Staphylococcus aureus aureus MSSA476 IMG   putative hydroxymyristoyl-(acyl carrier protein) dehydratase( EC:4.2.1.- )
img|637299831 Staphylococcus aureus aureus MW2 IMG   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
img|637816956 Staphylococcus aureus RF122 IMG   3R-hydroxymyristoyl ACP dehydratase( EC:4.2.1.- )
img|637888699 Staphylococcus aureus aureus USA300 IMG   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase( EC:4.2.1.- )
img|637894954 Staphylococcus aureus aureus NCTC 8325 IMG   beta-hydroxyacyl-ACP dehydratase, putative( EC:4.2.1.- )
img|639108942 Staphylococcus aureus aureus JH1 IMG   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
img|640566516 Staphylococcus aureus aureus JH9 IMG   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
img|640780280 Staphylococcus aureus aureus JH1 IMG   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
img|640796425 Staphylococcus aureus aureus Newman IMG   hydroxymyristoyl-(acyl carrier protein) dehydratase
img|640904872 Staphylococcus aureus aureus Mu3 IMG   #3R-hydroxymyristoyl-[acyl carrier protein] dehydratase
img|641310091 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase( EC:4.2.1.- )
kegg|saa:SAUSA300_2054 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase (EC:4.2.1.-)
kegg|sab:SAB1983c Staphylococcus aureus RF122 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|sac:SACOL2091 Staphylococcus aureus subsp. aureus COL KEGG   (3R)-hydroxymyristoyl-ACP dehydratase (EC:4.2.1.-)
kegg|sae:NWMN_2003 Staphylococcus aureus subsp. aureus Newman KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|sah:SaurJH1_2173 Staphylococcus aureus subsp. aureus JH1 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|saj:SaurJH9_2135 Staphylococcus aureus subsp. aureus JH9 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|sam:MW2023 Staphylococcus aureus subsp. aureus MW2 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|sao:SAOUHSC_02336 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   beta-hydroxyacyl-ACP dehydratase, putative (EC:4.2.1.-)
kegg|sar:SAR2187   KEGG   (3R)-hydroxymyristoyl-ACP dehydratase (EC:4.2.1.-)
kegg|sas:SAS2002   KEGG   (3R)-hydroxymyristoyl-ACP dehydratase (EC:4.2.1.-)
kegg|sau:SA1901   KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|sav:SAV2098   KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|saw:SAHV_2083 Staphylococcus aureus subsp. aureus Mu3 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase
kegg|sax:USA300HOU_2089 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   (3R)-hydroxymyristoyl-ACP dehydratase (EC:4.2.1.-)
ref|NP_372622.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|NP_375206.1 Staphylococcus aureus subsp. aureus N315 RefSeq   3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase
ref|NP_646840.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|YP_001247493.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|YP_001317289.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|YP_001333037.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   (3R)-hydroxymyristoyl-ACP dehydratase
ref|YP_001442673.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   (3R)-hydroxymyristoyl-ACP dehydratase
ref|YP_001575965.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|YP_041547.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
ref|YP_044113.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative hydroxymyristoyl-(acyl carrier protein) dehydratase
ref|YP_186906.1 Staphylococcus aureus subsp. aureus COL RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|YP_417441.1 Staphylococcus aureus RF122 RefSeq   3R-hydroxymyristoyl ACP dehydratase
ref|YP_494700.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   (3R)-hydroxymyristoyl-ACP dehydratase
ref|YP_500815.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   beta-hydroxyacyl-ACP dehydratase, putative
ref|ZP_03561864.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_03566111.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_03988863.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_04017365.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_04826803.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_04865228.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_04867232.1 acyl carrier protein RefSeq   (3R)-hydroxymyristoyl-
ref|ZP_05145488.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   (3R)-hydroxymyristoyl-ACP dehydratase
ref|ZP_05602653.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|ZP_05605290.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   hydroxymyristoyl-(acyl carrier protein) dehydratase
ref|ZP_05607878.1 acyl carrier protein RefSeq   3R-hydroxymyristoyl-
ref|ZP_05610564.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   hydroxymyristoyl
ref|ZP_05613167.1 Staphylococcus aureus subsp. aureus M876 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|ZP_05642836.1 Staphylococcus aureus A9781 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|ZP_05680175.1 Staphylococcus aureus A9763 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|ZP_05684964.1 acyl carrier protein RefSeq   3R-hydroxymyristoyl-
ref|ZP_05685801.1 acyl carrier protein RefSeq   3R-hydroxymyristoyl-
ref|ZP_05688657.1 Staphylococcus aureus A9299 RefSeq   hydroxymyristoyl
ref|ZP_05690649.1 acyl carrier protein RefSeq   3R-hydroxymyristoyl-
ref|ZP_05693865.1 Staphylococcus aureus A6300 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
ref|ZP_05698236.1 Staphylococcus aureus A6224 RefSeq   hydroxymyristoyl-(acyl carrier protein) dehydratase
ref|ZP_05701386.1 Staphylococcus aureus A5937 RefSeq   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
sp|A5IUP4 Staphylococcus aureus (strain JH9) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|A6QIU3 Staphylococcus aureus (strain Newman) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|A6U3I4 Staphylococcus aureus (strain JH1) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|A7X4T7 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|A8Z4Z7 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|FABZ_STAA1 acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAA2 acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAA3 acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAA8 acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAA9 acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAB acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAC acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAE acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAM acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAN acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAR acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAS acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAT acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|FABZ_STAAW acyl-carrier-protein SwissProt   RecName: Full=(3R)-hydroxymyristoyl-
sp|P64107 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|P64108 Staphylococcus aureus (strain N315) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|P64109 Staphylococcus aureus (strain MW2) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|Q2FF28 Staphylococcus aureus (strain USA300) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|Q2FWF5 Staphylococcus aureus (strain NCTC 8325) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|Q2YUK5 Staphylococcus aureus (strain bovine RF122 / ET3-1) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|Q5HEA1 Staphylococcus aureus (strain COL) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|Q6G7L1 Staphylococcus aureus (strain MSSA476) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
sp|Q6GEX6 Staphylococcus aureus (strain MRSA252) SwissProt   (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
tr|C2GAI2 Staphylococcus aureus subsp. aureus TCH60 TrEMBL   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
tr|C2K9S3 Staphylococcus aureus subsp. aureus MN8 TrEMBL   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
tr|C5N2N6 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
tr|C5PZB3 Staphylococcus aureus subsp. aureus TCH130 TrEMBL   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
tr|C5QDA4 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|158879.11.peg.2055 Single-stranded DNA-binding protein


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search