The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.2054: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
Translate Function Assignments



Context on contig NC_002745 from base 2146083 to 2157011 (10929 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2048 2146955 2146083 873 -       2: 15 12   Inner membrane protein translocase and chaperone YidC, short form OxaI-like locus|SA1893, protein_id|NP_375198.1, gi|15927665, geneID|1124794
2049 2147682 2147041 642 - 85     4: 3 5 1 2   Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3) gene_name|thiE, locus|SA1894, protein_id|NP_375199.1, gi|15927666, geneID|1124795
2050 2148475 2147684 792 - 1     3: 3 1 2   Hydroxyethylthiazole kinase (EC 2.7.1.50) gene_name|thiM, locus|SA1895, protein_id|NP_375200.1, gi|15927667, geneID|1124796
2051 2149289 2148459 831 - -17     4: 3 5 1 2   Hydroxymethylpyrimidine kinase (EC 2.7.1.49) @ Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7) gene_name|thiD, locus|SA1896, protein_id|NP_375201.1, gi|15927668, geneID|1124797
2052 2149971 2149282 690 - -8     1: 1   Thiaminase II (EC 3.5.99.2) involved in salvage of thiamin pyrimidine moiety locus|SA1897, protein_id|NP_375202.1, gi|15927669, geneID|1124798
2053 2150196 2150071 126 - 99         FIG01107883: hypothetical protein  
2054 2151053 2150358 696 - 161       dlit(17997515) SceD-like transglycosylase, biomarker for vancomycin-intermediate strains locus|SA1898, protein_id|NP_375203.1, gi|15927670, geneID|1124799
2055 2151837 2151442 396 - 388     3: 8 14 13   Single-stranded DNA-binding protein locus|SA1899, protein_id|NP_375204.1, gi|15927671, geneID|1124800
2056 2152031 2152471 441 + 193         Hypothetical protein SAV2097 locus|SA1900, protein_id|NP_375205.1, gi|15927672, geneID|1124801
2057 2152970 2152530 441 - 58     2: 11 10   3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form (EC 4.2.1.59) gene_name|fabZ, locus|SA1901, protein_id|NP_375206.1, gi|15927673, geneID|1124802
2058 2154269 2153004 1266 - 33     2: 6 9   UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) gene_name|murA, locus|SA1902, protein_id|NP_375207.1, gi|15927674, geneID|1124803
2059 2154613 2154380 234 - 110         Uncharacterized membrane protein YwzB locus|SA1903, protein_id|NP_375208.1, gi|15927675, geneID|1124804
2060 2155579 2155175 405 - 561     1: 4   ATP synthase epsilon chain (EC 7.1.2.2) gene_name|atpC, locus|SA1904, protein_id|NP_375209.1, gi|15927676, geneID|1124805
2061 2157011 2155599 1413 - 19     2: 7 4   ATP synthase beta chain (EC 7.1.2.2) gene_name|atpD, locus|SA1905, protein_id|NP_375210.1, gi|15927677, geneID|1124806

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.2054 SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
TFDYEGFTYHFESDGTHFAWNYHATGANGANMSAQAPATNNVEPSAVQANQVQSQEVEAP
QNAQTQQPQASTSNNSQVTATPTESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA

MD5 = cdf8db1f3c5755461a357c81391c3d47


  DNA Sequence

>fig|158879.11.peg.2054 SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
atgaagaaaacattactcgcatcatcattagcagtaggtttaggaatcgtagcaggaaat
gcaggtcacgaagcccatgcaagtgaagcggacttaaataaagcatctttagcgcaaatg
gcgcaatcaaatgatcaaacattaaatcaaaaaccaattgaagctggggcttataattat
acatttgactatgaagggtttacttatcactttgaatcagatggtacacactttgcttgg
aattaccatgcaacaggtgctaatggagcaaacatgagtgcacaagcacctgcaactaat
aatgttgaaccatcagctgttcaagctaatcaagtacaatcacaagaagttgaagcacca
caaaatgctcaaactcaacaaccacaagcatcaacatcaaacaattcacaagttactgca
acaccaactgaatcaaaagcatcagaaggttcatcagtaaatgtgaatgctcatctaaaa
caaattgctcaacgtgaatcaggtggcaatattcatgctgtaaatccaacatcaggtgca
gctggtaagtatcaattcttacaatcaacttgggattcagtagcacctgctaaatataaa
ggtgtatcaccagcaaatgctcctgaaagtgttcaagatgccgcagcagtaaaattatat
aacactggtggcgctggacattgggttactgcataa


  DNA with Flanking Sequence

>fig|158879.11.peg.2054 SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
tgaaacaataaaatttatgtcccctaaatcccaaaataatgaaattctctcagatagtat
tttagatattgactctcaaaatatagataatcatgacttattagaaatttaaatccaatt
atcctaaacatccttaatatacatttaatccatcctaaattttttatagatctaattaac
ttgaaatatactcaattaaaaacgacttacatgactagtactgttgtgtaggtcgtcttt
ttgtgtagtttttctaatagaaaatagacatagattgcaaaacgattacataaaaaattg
caaataaaaaacatttttactgtcatgacaattctcgatagaatcatatctgaaattatg
ggggatttcgttgtaatcactgtgtaaaaaacaaggctatttttttattttgttgtaacc
tgcacggattttatagatgttacagtagtctctgtaaaacttttagagaaacaaattact
tgtaggaggattttaagattatgaagaaaacattactcgcatcatcattagcagtaggtt
taggaatcgtagcaggaaatgcaggtcacgaagcccatgcaagtgaagcggacttaaata
aagcatctttagcgcaaatggcgcaatcaaatgatcaaacattaaatcaaaaaccaattg
aagctggggcttataattatacatttgactatgaagggtttacttatcactttgaatcag
atggtacacactttgcttggaattaccatgcaacaggtgctaatggagcaaacatgagtg
cacaagcacctgcaactaataatgttgaaccatcagctgttcaagctaatcaagtacaat
cacaagaagttgaagcaccacaaaatgctcaaactcaacaaccacaagcatcaacatcaa
acaattcacaagttactgcaacaccaactgaatcaaaagcatcagaaggttcatcagtaa
atgtgaatgctcatctaaaacaaattgctcaacgtgaatcaggtggcaatattcatgctg
taaatccaacatcaggtgcagctggtaagtatcaattcttacaatcaacttgggattcag
tagcacctgctaaatataaaggtgtatcaccagcaaatgctcctgaaagtgttcaagatg
ccgcagcagtaaaattatataacactggtggcgctggacattgggttactgcataagcca
tttatgcatagctaatcaatagttatataagtaacttttagatcggaatatatcggggaa
ttctcgatatgttccggtcttttttatttcgcaaatatacgtcattatagaattattatt
taaagataataatacaactgagcaacaataattgaaaatgttgaaaccgtttgctaagat
taatttgcaattgaatactaaggaactactaggggagcctaatgatatggctgagatgaa
ttgttcagacccttatgacctgatttggttagtaccaacgtaggaaagtagttattgaag
tgatggggctagtatagcaacattgccatcaaactactttcatgttggaagtagtttttt
tatttagggaggattttttacaatggaattttcacaaaaattgtaccaagctgcaaagcc
aatcattaatgatatttatgaggatgactttattcagaagatgttatccggagatatagg
agctgacgcattacgc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005576       C:extracellular region
GO:0008152       P:metabolic process
GO:0016798       F:hydrolase activity, acting on glycosyl bonds
cmr|NT01SA2089 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA2100 Staphylococcus aureus Mu50     SceD precursor
dbj|BAB43182.1 Staphylococcus aureus subsp. aureus N315     SA1898
dbj|BAB58257.1 Staphylococcus aureus subsp. aureus Mu50     similar to SceD precursor
dbj|BAF78963.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2095 Staphylococcus aureus subsp. aureus Mu50 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|158878.14.peg.2170 Staphylococcus aureus subsp. aureus Mu50 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|158879.1.peg.1965 Staphylococcus aureus subsp. aureus N315 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|359786.13.peg.2249 Staphylococcus aureus subsp. aureus JH9 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|359786.3.peg.615 Staphylococcus aureus subsp. aureus JH9 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|359787.11.peg.2217 Staphylococcus aureus subsp. aureus JH1 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|359787.3.peg.306 Staphylococcus aureus subsp. aureus JH1 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|418127.4.peg.1931 Staphylococcus aureus subsp. aureus Mu3 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|418127.6.peg.2138 Staphylococcus aureus subsp. aureus Mu3 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|450394.6.peg.2617 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|505321.3.peg.2735 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553565.3.peg.127 Staphylococcus aureus A5937 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553568.3.peg.2484 Staphylococcus aureus A6224 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553571.3.peg.718 Staphylococcus aureus A6300 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553573.3.peg.42 Staphylococcus aureus A8115 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553574.3.peg.2059 Staphylococcus aureus A8117 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553577.3.peg.2083 Staphylococcus aureus A8796 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553580.3.peg.2170 Staphylococcus aureus A8819 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553581.3.peg.690 Staphylococcus aureus A9299 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553588.3.peg.2380 Staphylococcus aureus A9719 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553592.3.peg.147 Staphylococcus aureus A9763 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|553596.3.peg.722 Staphylococcus aureus A9781 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|585891.3.peg.2167 Staphylococcus aureus subsp. aureus Mu50-omega FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|680649.3.peg.2256 Staphylococcus aureus subsp. aureus MR1 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|681288.4.peg.2115 Staphylococcus aureus subsp. aureus ED98 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
fig|703339.3.peg.2076 Staphylococcus aureus 04-02981 FIG   SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
gb|ABQ49914.1 Staphylococcus aureus subsp. aureus JH9     Transglycosylase domain protein
gb|ABR52999.1 Staphylococcus aureus subsp. aureus JH1     Transglycosylase domain protein
gb|EES93923.1 Staphylococcus aureus subsp. aureus USA300_TCH959     immunodominant antigen A
gb|EEV26166.1 Staphylococcus aureus A9781     transglycosylase
gb|EEV65799.1 Staphylococcus aureus A9763     transglycosylase
gb|EEV66376.1 Staphylococcus aureus A9719     transglycosylase domain-containing protein
gb|EEV73297.1 Staphylococcus aureus A9299     SceD protein
gb|EEV76469.1 Staphylococcus aureus A8115     transglycosylase domain-containing protein
gb|EEV78466.1 Staphylococcus aureus A6300     transglycosylase domain-containing protein
gb|EEV79524.1 Staphylococcus aureus A6224     transglycosylase domain-containing protein
gb|EEV87128.1 Staphylococcus aureus A5937     transglycosylase domain-containing protein
gi|13701890 Staphylococcus aureus subsp. aureus N315 NCBI   SA1898
gi|14247868 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to SceD precursor
gi|147741616 Staphylococcus aureus subsp. aureus JH9 NCBI   Transglycosylase domain protein
gi|148268547 Staphylococcus aureus subsp. aureus JH9 NCBI   transglycosylase domain-containing protein
gi|149947063 Staphylococcus aureus subsp. aureus JH1 NCBI   Transglycosylase domain protein
gi|150394611 Staphylococcus aureus subsp. aureus JH1 NCBI   transglycosylase domain-containing protein
gi|156722546 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980411 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2080
gi|15925085 Staphylococcus aureus subsp. aureus Mu50 NCBI   SceD precursor
gi|15927670 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1898
gi|182637981 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable transglycosylase sceD; Flags: Precursor
gi|253317149 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_13659
gi|253725194 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   immunodominant antigen A
gi|253731067 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   immunodominant antigen A
gi|255006884 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_10460
gi|257787826 Staphylococcus aureus A9781 NCBI   transglycosylase
gi|257793854 Staphylococcus aureus A9781 NCBI   transglycosylase
gi|257841355 Staphylococcus aureus A9763 NCBI   transglycosylase
gi|257841944 Staphylococcus aureus A9719 NCBI   transglycosylase domain-containing protein
gi|257849318 Staphylococcus aureus A9299 NCBI   SceD protein
gi|257852551 Staphylococcus aureus A8115 NCBI   transglycosylase domain-containing protein
gi|257855529 Staphylococcus aureus A6300 NCBI   transglycosylase domain-containing protein
gi|257856618 Staphylococcus aureus A6224 NCBI   transglycosylase domain-containing protein
gi|257864382 Staphylococcus aureus A5937 NCBI   transglycosylase domain-containing protein
gi|258407022 Staphylococcus aureus A9763 NCBI   transglycosylase
gi|258422044 Staphylococcus aureus A9719 NCBI   transglycosylase domain-containing protein
gi|258433587 Staphylococcus aureus A9299 NCBI   SceD protein
gi|258440482 Staphylococcus aureus A8115 NCBI   transglycosylase domain-containing protein
gi|258445690 Staphylococcus aureus A6300 NCBI   transglycosylase domain-containing protein
gi|258450144 Staphylococcus aureus A6224 NCBI   transglycosylase domain-containing protein
gi|258453401 Staphylococcus aureus A5937 NCBI   transglycosylase domain-containing protein
gi|81705325 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable transglycosylase sceD; Flags: Precursor
gi|81781178 organism not parsed/found in ncbi nr NCBI   RecName: Full=Probable transglycosylase sceD; Flags: Precursor
img|637093624 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100644 Staphylococcus aureus aureus Mu50 IMG   similar to SceD precursor
img|639108939 Staphylococcus aureus aureus JH1 IMG   Transglycosylase-like
img|640566513 Staphylococcus aureus aureus JH9 IMG   Transglycosylase domain protein
img|640780277 Staphylococcus aureus aureus JH1 IMG   Transglycosylase domain protein
img|640904869 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_2170 Staphylococcus aureus subsp. aureus JH1 KEGG   transglycosylase domain-containing protein
kegg|saj:SaurJH9_2132 Staphylococcus aureus subsp. aureus JH9 KEGG   transglycosylase domain-containing protein
kegg|sau:SA1898   KEGG   hypothetical protein
kegg|sav:SAV2095   KEGG   SceD precursor
kegg|saw:SAHV_2080 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372619.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   SceD precursor
ref|NP_375203.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1898
ref|YP_001247490.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   transglycosylase domain-containing protein
ref|YP_001317286.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   transglycosylase domain-containing protein
ref|YP_001442670.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2080
ref|ZP_04840362.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_13659
ref|ZP_04865232.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   immunodominant antigen A
ref|ZP_05145485.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_10460
ref|ZP_05642833.1 Staphylococcus aureus A9781 RefSeq   transglycosylase
ref|ZP_05680172.1 Staphylococcus aureus A9763 RefSeq   transglycosylase
ref|ZP_05684961.1 Staphylococcus aureus A9719 RefSeq   transglycosylase domain-containing protein
ref|ZP_05688660.1 Staphylococcus aureus A9299 RefSeq   SceD protein
ref|ZP_05690652.1 Staphylococcus aureus A8115 RefSeq   transglycosylase domain-containing protein
ref|ZP_05693868.1 Staphylococcus aureus A6300 RefSeq   transglycosylase domain-containing protein
ref|ZP_05698239.1 Staphylococcus aureus A6224 RefSeq   transglycosylase domain-containing protein
ref|ZP_05701383.1 Staphylococcus aureus A5937 RefSeq   transglycosylase domain-containing protein
sp|A7X4T4 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Probable transglycosylase sceD precursor
sp|Q7A4F2 Staphylococcus aureus (strain N315) SwissProt   Probable transglycosylase sceD precursor
sp|Q99SG2 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Probable transglycosylase sceD precursor
sp|SCED_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable transglycosylase sceD; Flags: Precursor
sp|SCED_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable transglycosylase sceD; Flags: Precursor
sp|SCED_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Probable transglycosylase sceD; Flags: Precursor
tr|A5IUP1 Staphylococcus aureus (strain JH9) TrEMBL   Transglycosylase domain protein precursor
tr|A6U3I1 Staphylococcus aureus (strain JH1) TrEMBL   Transglycosylase domain protein precursor
tr|C5N2P0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Immunodominant antigen A


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(17997515);SvetaG


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search