The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1986: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Integrase, superantigen-encoding pathogenicity islands SaPI
Translate Function Assignments



Context on contig NC_002745 from base 2066368 to 2077330 (10963 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1978 2068077 2066368 1710 -       2: 1 2   Putative DNA helicase, superantigen-encoding pathogenicity islands SaPI locus|SA1828, protein_id|NP_375129.1, gi|15927596, geneID|1124720
1979 2068960 2068091 870 - 13     1: 1   Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1829, protein_id|NP_375130.1, gi|15927597, geneID|1124721
1980 2069351 2069025 327 - 64     1: 1   Hypothetical SAV0789 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1830, protein_id|NP_375131.1, gi|15927598, geneID|1124722
1981 2069563 2069354 210 - 2     1: 1   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1831, protein_id|NP_375132.1, gi|15927599, geneID|1124723
1982 2069702 2069556 147 - -8     1: 1   Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI  
1983 2070016 2069699 318 - -4     1: 1   Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1832, protein_id|NP_375133.1, gi|15927600, geneID|1124724
1984 2070239 2070021 219 - 4     1: 1   Hypothetical SAV2026 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1833, protein_id|NP_375134.1, gi|15927601, geneID|1124725
1985 2070412 2071086 675 + 172     1: 1   Hypothetical SAV2027 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1834, protein_id|NP_375135.1, gi|15927602, geneID|1124726
1986 2071100 2072272 1173 + 13     1: 1   Integrase, superantigen-encoding pathogenicity islands SaPI gene_name|int, locus|SA1835, protein_id|NP_375136.1, gi|15927603, geneID|1124727
1987 2073957 2072341 1617 - 68     4: 1 4 2 3   Heat shock protein 60 kDa family chaperone GroEL gene_name|groEL, locus|SA1836, protein_id|NP_375137.1, gi|15927604, geneID|1124728
1988 2074317 2074033 285 - 75     1: 3 dlit(7916607) Heat shock protein 10 kDa family chaperone GroES gene_name|groES, locus|SA1837, protein_id|NP_375138.1, gi|15927605, geneID|1124729
1989 2074492 2075235 744 + 174         Hypothetical protein SAV2031 locus|SA1838, protein_id|NP_375139.1, gi|15927606, geneID|1124730
1990 2076507 2075260 1248 - 24         Membrane anchored protein locus|SA1839, protein_id|NP_375140.1, gi|15927607, geneID|1124731
1991 2076704 2077330 627 + 196         Nitroreductase family protein locus|SA1840, protein_id|NP_375141.1, gi|15927608, geneID|1124732

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_pathogenicity_islands_SaPI SvetaG Integrase, superantigen-encoding pathogenicity islands SaPI


  Protein Sequence

>fig|158879.11.peg.1986 Integrase, superantigen-encoding pathogenicity islands SaPI
MASYEKRGNTWRYRISLGKDAETGKYKYISNSGFKRKSDAKHHAEMVERQLRNGDYIAPS
TSTFKQVADDWISQYANEVKVSSVRAREKAIHHAIERFKNKPIQTIKKHDYQRFVNDISI
QYSKNYVDSIVTSTNMIFKYAYDMKLIRILPSEGIKRPKKKVSVEELEDTEIHKKFLEKD
ELFQFLEIAKNHHSPQNSFEVFYTLAYTGMRAGELLALKWSDIDFENNTINITKTYYNPN
NNKKQYQILTPKTESSIGKISVDPHVIKLLKNYKVDVQDTWKNELYVDNNFVFTDVNGYP
LVIKKLQLWIKAILKKTNITNKQISTHSFRHTHCALLIEAGVHIKEIQERLRHKDINTTM
NIYAKITNSYKKDASQKFSKLMENVSKDLF

MD5 = 306c1b396585f86a34c2c8d35b782295


  DNA Sequence

>fig|158879.11.peg.1986 Integrase, superantigen-encoding pathogenicity islands SaPI
atggcaagttatgaaaaacgcggaaatacatggcgctatcgtatatcactaggaaaagac
gcagaaacgggcaaatataaatatatttcaaactcaggttttaaacgcaaatcagacgct
aaacatcacgctgaaatggttgagcgtcaattaagaaatggcgattatatcgcaccgtcc
acatctacatttaaacaggttgctgacgattggatatcacaatatgctaacgaagtaaaa
gtaagtagtgtcagagcacgcgagaaagccatacatcatgctatagaacgctttaagaac
aaaccaatacaaactatcaaaaaacacgattatcaacgttttgtaaacgatataagcata
cagtatagcaagaattatgttgatagcattgtaacctctacaaatatgatatttaagtac
gcttatgatatgaaattaataagaatattgcctagcgagggtattaaacgacctaaaaag
aaagttagtgtggaagaattagaagatactgagatacataaaaagtttcttgaaaaagat
gaattatttcaatttctggaaattgccaaaaatcaccattcgccacaaaatagctttgaa
gtgttttatacattagcatatacaggcatgcgtgcaggtgaattattggcattgaagtgg
tctgatatagactttgagaataacacaatcaatattacaaagacttattacaatccgaat
aacaataaaaagcaatatcaaatacttacgccaaaaactgaaagctcaatcggaaaaatt
tcagttgatcctcatgtgattaaattactcaaaaattataaagtggatgtacaggacaca
tggaaaaacgagttgtatgtagataacaatttcgtttttactgatgttaacggctatccc
ctcgtaattaagaaactacagttatggataaaagctatacttaaaaagactaacataact
aataaacaaataagcactcattcatttcgtcatactcattgcgcgttacttatagaggct
ggtgtgcatattaaggaaatacaagaacgcttgcgacacaaagatataaacaccactatg
aacatctacgctaagattacgaactcatacaaaaaagacgcttcccaaaagtttagtaaa
ctcatggaaaacgtctcaaaagatttattttaa


  DNA with Flanking Sequence

>fig|158879.11.peg.1986 Integrase, superantigen-encoding pathogenicity islands SaPI
acataatccgatcaattttgactttacttttgatgaagaaccgaattataaaattaatga
tgttttcgagggatttgaagtaactgcaaacattactcacgctttttcgattgaaaattt
tgactttgaaattttagtagacgtcgaattagataataggcaaaaattaaattttgactt
agacgtctcatataaagaaactgaaaagataactaattcacaacatagatttattttcac
gattaaaaatgaagatgaaaatatcggattaaaaaaatacgttgatagtttatctgcagg
ccttaaaaacttgttatttaaaaaaattaaccaaaagttaagtgggtatgtttctgaaat
aatagtaaaaaatatagacgatattgaagagctttttccaaataaaggcgaaaaaagtac
gactctacataaagaaattttacaaactgatagccgtttatctagtgatatttttaaaga
atattaatcgaggtgatcaaatggcaagttatgaaaaacgcggaaatacatggcgctatc
gtatatcactaggaaaagacgcagaaacgggcaaatataaatatatttcaaactcaggtt
ttaaacgcaaatcagacgctaaacatcacgctgaaatggttgagcgtcaattaagaaatg
gcgattatatcgcaccgtccacatctacatttaaacaggttgctgacgattggatatcac
aatatgctaacgaagtaaaagtaagtagtgtcagagcacgcgagaaagccatacatcatg
ctatagaacgctttaagaacaaaccaatacaaactatcaaaaaacacgattatcaacgtt
ttgtaaacgatataagcatacagtatagcaagaattatgttgatagcattgtaacctcta
caaatatgatatttaagtacgcttatgatatgaaattaataagaatattgcctagcgagg
gtattaaacgacctaaaaagaaagttagtgtggaagaattagaagatactgagatacata
aaaagtttcttgaaaaagatgaattatttcaatttctggaaattgccaaaaatcaccatt
cgccacaaaatagctttgaagtgttttatacattagcatatacaggcatgcgtgcaggtg
aattattggcattgaagtggtctgatatagactttgagaataacacaatcaatattacaa
agacttattacaatccgaataacaataaaaagcaatatcaaatacttacgccaaaaactg
aaagctcaatcggaaaaatttcagttgatcctcatgtgattaaattactcaaaaattata
aagtggatgtacaggacacatggaaaaacgagttgtatgtagataacaatttcgttttta
ctgatgttaacggctatcccctcgtaattaagaaactacagttatggataaaagctatac
ttaaaaagactaacataactaataaacaaataagcactcattcatttcgtcatactcatt
gcgcgttacttatagaggctggtgtgcatattaaggaaatacaagaacgcttgcgacaca
aagatataaacaccactatgaacatctacgctaagattacgaactcatacaaaaaagacg
cttcccaaaagtttagtaaactcatggaaaacgtctcaaaagatttattttaaaatttct
atgaccaaattacgaccacccaatattacaaactttataaaatcagcgtttaacagtcgt
tttacatcattcccggcatgccacccatgttaggttggtcattatttttttctggaattg
atgctacaaccgcttcagtcgttaagaacattgctgcaacacttgcagcatgttgtaatg
ctgagcgtgttactttagttggatcaacgatacctgcttctaacatattaacccactcgt
ttgtagcagcgttaaaaccaacacccggctctgcgtttttcaaacgttctacaataacag
aaccttctaatcctgcattttcagcaatttgacgaactggtgcagttagtgctttaagta
caatatttacacctgtttcaatgtcaccttctgcttcaatttcacttactttttggtaaa
catttactaatgcagtaccaccacctgcaacaataccttcttcaactgctgcacgtgtag
aatttaatgcatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003677       F:DNA binding
GO:0006310       P:DNA recombination
GO:0015074       P:DNA integration
cmr|NT01SA2017 Staphylococcus aureus N315     integrase, phage family, putative
cmr|NT02SA2028 Staphylococcus aureus Mu50     integrase-like protein
dbj|BAB43115.1 Staphylococcus aureus subsp. aureus N315     int
dbj|BAB58190.1 Staphylococcus aureus subsp. aureus Mu50     similar to integrase
dbj|BAF78896.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2028 Staphylococcus aureus subsp. aureus Mu50 FIG   Integrase, superantigen-encoding pathogenicity islands SaPI
fig|158878.14.peg.2102 Staphylococcus aureus subsp. aureus Mu50 FIG   Integrase, superantigen-encoding pathogenicity islands SaPI
fig|158879.1.peg.1898 Staphylococcus aureus subsp. aureus N315 FIG   Integrase, superantigen-encoding pathogenicity islands SaPI
fig|418127.4.peg.1867 Staphylococcus aureus subsp. aureus Mu3 FIG   Integrase, superantigen-encoding pathogenicity islands SaPI
fig|418127.6.peg.2071 Staphylococcus aureus subsp. aureus Mu3 FIG   Integrase, superantigen-encoding pathogenicity islands SaPI
fig|585891.3.peg.2099 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Integrase, superantigen-encoding pathogenicity islands SaPI
gi|13701822 Staphylococcus aureus subsp. aureus N315 NCBI   int
gi|14247801 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to integrase
gi|156722479 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980344 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2013
gi|15925018 Staphylococcus aureus subsp. aureus Mu50 NCBI   integrase
gi|15927603 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1835
gi|255006817 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_10125
img|637093552 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100572 Staphylococcus aureus aureus Mu50 IMG   similar to integrase
img|640904797 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sau:SA1835   KEGG   hypothetical protein
kegg|sav:SAV2028   KEGG   integrase
kegg|saw:SAHV_2013 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372552.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   integrase
ref|NP_375136.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1835
ref|YP_001442603.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2013
ref|ZP_05145418.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_10125
tr|A7X4J0 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein int
tr|Q7A4J3 Staphylococcus aureus (strain N315) TrEMBL   Int protein
tr|Q99SL8 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to integrase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search