The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1976: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
Translate Function Assignments



Context on contig NC_002745 from base 2059637 to 2071086 (11450 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1967 2059637 2060197 561 +       1: 1   Secreted protein Ear, superantigen-encoding pathogenicity islands SaPI locus|SA1818, protein_id|NP_375119.1, gi|15927586, geneID|1124710
1968 2060631 2060500 132 - 302         FIG01108529: hypothetical protein  
1969 2061076 2061780 705 + 444     1: 1   Toxic shock syndrome toxin 1 (TSST-1) gene_name|tst, locus|SA1819, protein_id|NP_375120.1, gi|15927587, geneID|1124711
1970 2062504 2061935 570 - 154     1: 1   Phage terminase, small subunit locus|SA1820, protein_id|NP_375121.1, gi|15927588, geneID|1124712
1971 2062842 2062501 342 - -4     1: 1   Hypothetical SAV0799 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1821, protein_id|NP_375122.1, gi|15927589, geneID|1124713
1972 2063372 2062845 528 - 2     1: 1   Hypothetical SAV0798 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1822, protein_id|NP_375123.1, gi|15927590, geneID|1124714
1973 2063641 2063423 219 - 50     1: 1   Hypothetical SAV0797 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1823, protein_id|NP_375124.1, gi|15927591, geneID|1124715
1974 2064237 2063659 579 - 17     1: 1   Hypothetical SAV0796 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1824, protein_id|NP_375125.1, gi|15927592, geneID|1124716
1975 2064590 2064249 342 - 11     1: 1   Hypothetical SAV0795 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1825, protein_id|NP_375126.1, gi|15927593, geneID|1124717
1976 2065681 2065040 642 - 449     1: 1   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1826, protein_id|NP_375127.1, gi|15927594, geneID|1124718
1977 2066058 2065678 381 - -4     1: 1   Hypothetical SAV0792 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1827, protein_id|NP_375128.1, gi|15927595, geneID|1124719
1978 2068077 2066368 1710 - 309     2: 1 2   Putative DNA helicase, superantigen-encoding pathogenicity islands SaPI locus|SA1828, protein_id|NP_375129.1, gi|15927596, geneID|1124720
1979 2068960 2068091 870 - 13     1: 1   Hypothetical SAV0790 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1829, protein_id|NP_375130.1, gi|15927597, geneID|1124721
1980 2069351 2069025 327 - 64     1: 1   Hypothetical SAV0789 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1830, protein_id|NP_375131.1, gi|15927598, geneID|1124722
1981 2069563 2069354 210 - 2     1: 1   Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1831, protein_id|NP_375132.1, gi|15927599, geneID|1124723
1982 2069702 2069556 147 - -8     1: 1   Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI  
1983 2070016 2069699 318 - -4     1: 1   Hypothetical SAV0787 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1832, protein_id|NP_375133.1, gi|15927600, geneID|1124724
1984 2070239 2070021 219 - 4     1: 1   Hypothetical SAV2026 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1833, protein_id|NP_375134.1, gi|15927601, geneID|1124725
1985 2070412 2071086 675 + 172     1: 1   Hypothetical SAV2027 homolog in superantigen-encoding pathogenicity islands SaPI locus|SA1834, protein_id|NP_375135.1, gi|15927602, geneID|1124726

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Staphylococcal_pathogenicity_islands_SaPI SvetaG Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI


  Protein Sequence

>fig|158879.11.peg.1976 Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
MNLETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDMVYVMMNSKLFGHVYIK
DCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKHLSISDMMASHLFEDEYFMYGLQT
YAESNNSDVFEYLENGFDTDTLEGIQSSNTDVIANIEMLYQLATGINEPAPELVEGLKLV
TEFVQDENATQEDYKALERKLNDLKASYYSLSK

MD5 = e0dfed5fe543b59d42204eb76ffa8b9a


  DNA Sequence

>fig|158879.11.peg.1976 Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
atgaacttagaaactatcgtaaaccaatttgaaacacgagcaggcacgttactaaggtac
tacacaggattattagaacatagtaaagtgcaaccgtgttgctttaagttatacaatgat
ccatttgatatggtatacgtgatgatgaacagcaagctattcggtcatgtatatattaaa
gattgtaaagtaaggcaatcatttgaattagcgtcacctaagcacactgaggggcttata
agaagcatagaggggcattatgtaggttatgaattacatgacggtaaacatctttctatt
agtgatatgatggctagtcatttgtttgaagatgagtattttatgtatggattacaaaca
tatgcagaatcaaataatagtgatgtgtttgagtacctagaaaatggatttgatacagat
acacttgagggcattcaatcaagtaatactgatgtgatagcgaatattgaaatgttgtat
cagttagctacgggaatcaatgaaccagcaccagagttagttgagggattaaaattagta
actgagtttgtacaagatgagaatgcgacacaagaggattacaaggctttagaacgtaaa
ttgaatgatctaaaagcgtcttactatagcttgagtaaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.1976 Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
tactttgtgtactaattatcacgaggctatatatatcaatgttttaaccagtacacgaaa
gtaaaaaaaggtgtgtatttaactgtgtatggtacacaatcaatataaatatggaggtta
cacatggataaagaacaacttaaaaagtatatatacgaatatgtgaaagaatataaggag
ataccgatatatcagttagaagatttgtttaaagaaataaatcacgactatatagggaga
actagtatcacacacgataaggatgagaatattgtgttttggagtggatggaacaaaatt
acaatgtttgcgttgattgaattagttaaaagtgaacaacttgatttagtgtatagaggt
agttttataatgcgttatttgttggatggtagagttcctaatttaccattagctatttgt
tatccagaagatggacaacaaactgacgtgccctcatgggtgcctatggtattaagaata
aataaagaggagaaaatcaaatgaacttagaaactatcgtaaaccaatttgaaacacgag
caggcacgttactaaggtactacacaggattattagaacatagtaaagtgcaaccgtgtt
gctttaagttatacaatgatccatttgatatggtatacgtgatgatgaacagcaagctat
tcggtcatgtatatattaaagattgtaaagtaaggcaatcatttgaattagcgtcaccta
agcacactgaggggcttataagaagcatagaggggcattatgtaggttatgaattacatg
acggtaaacatctttctattagtgatatgatggctagtcatttgtttgaagatgagtatt
ttatgtatggattacaaacatatgcagaatcaaataatagtgatgtgtttgagtacctag
aaaatggatttgatacagatacacttgagggcattcaatcaagtaatactgatgtgatag
cgaatattgaaatgttgtatcagttagctacgggaatcaatgaaccagcaccagagttag
ttgagggattaaaattagtaactgagtttgtacaagatgagaatgcgacacaagaggatt
acaaggctttagaacgtaaattgaatgatctaaaagcgtcttactatagcttgagtaaat
aatgttatgaggggtcacatgtagtgtgtggctcctaataaaatactatgattttatacg
aggtatagcagtttaaaatggtaaggttttcggaaggtgttggcttttaaaatcggaagg
tatacagtctttgagaattgaaaaaatggcaagatttgtgcaaggtgtgcgaactttgtt
aacgctaatacaagctaaagtttgtgtttttggcataggcctaaaagttaagtttgttcg
ctgtttgttcgtgttattttaccgaacttaagttctatattaggttaatgtgaaaagcct
aacgttaagtttataacatgattttataagtgttatatatgataagctaaacaattgata
aaacgcgctataaagcgaacgtaagtttgttttagacctgtaaaaatggtataatttagg
tatgaaataattaaaagaaagaggtgtagaaatgcaaagtatcgcagaaaaagagacgta
tcatttacccaccgaacacctg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA2007 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA2019 Staphylococcus aureus Mu50     conserved hypothetical protein
dbj|BAB43106.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
dbj|BAB58181.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF78887.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.2019 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158878.14.peg.2092 Staphylococcus aureus subsp. aureus Mu50 FIG   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
fig|158879.1.peg.1889 Staphylococcus aureus subsp. aureus N315 FIG   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
fig|418127.4.peg.1858 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
fig|418127.6.peg.2061 Staphylococcus aureus subsp. aureus Mu3 FIG   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
fig|585891.3.peg.2089 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Hypothetical SAV0794 homolog in superantigen-encoding pathogenicity islands SaPI
gi|13701813 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|14247792 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|156722470 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156980335 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_2004
gi|15925009 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV2019
gi|15927594 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1826
gi|255006807 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_10075
img|637093543 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100563 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|640904788 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sau:SA1826   KEGG   hypothetical protein
kegg|sav:SAV2019   KEGG   hypothetical protein
kegg|saw:SAHV_2004 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372543.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV2019
ref|NP_375127.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1826
ref|YP_001442594.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_2004
ref|ZP_05145408.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_10075
tr|A7X4H9 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A4K1 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1826
tr|Q99SM7 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search