The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1935: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Phage protein
Translate Function Assignments



Context on contig NC_002745 from base 2028465 to 2040882 (12418 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1923 2029652 2028465 1188 -           Phage portal protein locus|SA1776, protein_id|NP_375074.1, gi|15927541, geneID|1124665
1924 2031329 2029668 1662 - 15         Phage terminase, large subunit locus|SA1777, protein_id|NP_375075.1, gi|15927542, geneID|1124666
1925 2031670 2031326 345 - -4         Phage terminase, small subunit locus|SA1778, protein_id|NP_375076.1, gi|15927543, geneID|1124667
1926 2032101 2031802 300 - 131         Phage HNH endonuclease locus|SA1779, protein_id|NP_375077.1, gi|15927544, geneID|1124668
1927 2032749 2032333 417 - 231         Phage integrase regulator RinA locus|SA1780, protein_id|NP_375078.1, gi|15927545, geneID|1124669
1928 2032977 2032777 201 - 27         Phage protein locus|SA1781, protein_id|NP_375079.1, gi|15927546, geneID|1124670
1929 2033126 2032977 150 - -1         Phage integrase regulator RinB locus|SAS062, protein_id|NP_375080.1, gi|15927547, geneID|1124671
1930 2033329 2033123 207 - -4         Phage phi 11 orf26a protein homolog locus|SA1782, protein_id|NP_375081.1, gi|15927548, geneID|1124672
1931 2033571 2033326 246 - -4         Phage protein locus|SA1783, protein_id|NP_375082.1, gi|15927549, geneID|1124673
1932 2034144 2033608 537 - 36     1: 4   Phage dimeric dUTPase (EC 3.6.1.23) locus|SA1784, protein_id|NP_375083.1, gi|15927550, geneID|1124674
1933 2034389 2034141 249 - -4         Phage phi 11 orf23 protein homolog locus|SA1785, protein_id|NP_375084.1, gi|15927551, geneID|1124675
1934 2034643 2034401 243 - 11         hypothetical protein locus|SA1786, protein_id|NP_375085.1, gi|15927552, geneID|1124676
1935 2034903 2034646 258 - 2         Phage protein locus|SA1787, protein_id|NP_375086.1, gi|15927553, geneID|1124677
1936 2035274 2034903 372 - -1         Phage phi 11 orf21 protein homolog locus|SA1788, protein_id|NP_375087.1, gi|15927554, geneID|1124678
1937 2035691 2035287 405 - 12         Phage-encoded crossover junction endodeoxyribonuclease RusA (EC 3.1.22.4) locus|SA1789, protein_id|NP_375088.1, gi|15927555, geneID|1124679
1938 2035918 2035700 219 - 8         Phage protein locus|SA1790, protein_id|NP_375089.1, gi|15927556, geneID|1124680
1939 2036818 2035925 894 - 6         Phage DNA replication protein O locus|SA1791, protein_id|NP_375090.1, gi|15927557, geneID|1124681
1940 2037318 2036848 471 - 29     1: 3   Phage ssDNA binding protein locus|SA1792, protein_id|NP_375091.1, gi|15927558, geneID|1124682
1941 2037804 2037319 486 - 0     1: 1   Metallo-beta-lactamase superfamily domain protein in prophage locus|SA1793, protein_id|NP_375092.1, gi|15927559, geneID|1124683
1942 2038937 2038017 921 - 212     1: 2   Phage recombination protein Bet locus|SA1794, protein_id|NP_375093.1, gi|15927560, geneID|1124684
1943 2040882 2038939 1944 - 1         Phage DNA repair ATPase locus|SA1795, protein_id|NP_375094.1, gi|15927561, geneID|1124685

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.1935 Phage protein
MSVISNRKVDMNEIQDNVKQPAHYTYGDIEIIDFIEQVTAQYPPQLAFAIGNAIKYLSRA
PLKNGHEDLAKAKFYVQRAFDLWEQ

MD5 = b5aa8eaee6dae45070e33bae9d3b42df


  DNA Sequence

>fig|158879.11.peg.1935 Phage protein
atgagtgtaatcagtaacagaaaagtagatatgaatgaaatacaagacaatgttaagcaa
ccagcgcactacacatacggcgacattgaaattatagattttatcgaacaggttacggcg
cagtatccaccacaattagcatttgcaataggtaatgcaatcaaatatctatctagagca
ccgttgaaaaacggacacgaggatttagcaaaggcgaagttttatgtccaaagagctttt
gacttgtgggagcaatga


  DNA with Flanking Sequence

>fig|158879.11.peg.1935 Phage protein
gtattagatgcttgtaatggccatgtatggaaagacgataaccaaattacagaaataact
agctcaaagcgttatggaattgagcccaaaataatcatacgaatagaagaaatataagag
gtggataaaatggcgagaaaagcaaggattgtaacaataaatgataaaccttataggttc
agtaaatttgaaatggaattaatagaaagtcacggtataaccgctggaatggtttctaag
agagtaaaagacggttgggaactacatgaagcaatggacgcaccagaaggtacgcgttta
agcgagtacagagaaaagaaaacaatagaaagactggaacaagctagactcgaacgcaaa
ttggaaagaaagcgaaagagagaggctgagctaagaagaaagaagccacacttgtttaat
gtacctcagaaacattcacgtgatccgtactggtttgataatacttataaccaaatgttc
aagaaatggagtgaagcataatgagtgtaatcagtaacagaaaagtagatatgaatgaaa
tacaagacaatgttaagcaaccagcgcactacacatacggcgacattgaaattatagatt
ttatcgaacaggttacggcgcagtatccaccacaattagcatttgcaataggtaatgcaa
tcaaatatctatctagagcaccgttgaaaaacggacacgaggatttagcaaaggcgaagt
tttatgtccaaagagcttttgacttgtgggagcaatgactatgacatataacgcgcgcaa
agaatacttaaaccaatttttcggatctaagagatatctgtatcaggataacgaacgagt
ggcacatatccatgtagtgaatggcacttattactttcacgggcatatcgtgccaggttg
gcaaagcgttaaaaagacatttgatactgctgaagagctcgaaatatatataaagcaaca
tggtttggaatacgaggaacagaagcaactaactttattttagaggagatggaaatgatg
aataatcgtgaacaaattgaacaatccgttataagtgctagtgcgtataacggcaatgac
acagagggattgctaaaagagattgaggacgtgtataagaaagcgcgagcatttgatgaa
atacttgatggaatgacaaatgctattcaacattcagttaaagaaggtattgaacttgat
gaagcagtaggaattatggcaggtcaagttatctataaatatgaggaggaacaaggaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA1964 Staphylococcus aureus N315     conserved hypothetical protein
dbj|BAB43065.1 Staphylococcus aureus subsp. aureus N315     hypothetical protein
fig|158879.1.peg.1848 Staphylococcus aureus subsp. aureus N315 FIG   Phage protein
fig|225979.1.peg.26 Staphylococcus phage phiN315 FIG   Phage protein
fig|359786.13.peg.2150 Staphylococcus aureus subsp. aureus JH9 FIG   Phage protein
fig|359786.3.peg.1554 Staphylococcus aureus subsp. aureus JH9 FIG   Phage protein
fig|359787.11.peg.2119 Staphylococcus aureus subsp. aureus JH1 FIG   Phage protein
fig|359787.3.peg.2082 Staphylococcus aureus subsp. aureus JH1 FIG   Phage protein
fig|505321.3.peg.453 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Phage protein
fig|553568.3.peg.285 Staphylococcus aureus A6224 FIG   Phage protein
fig|553577.3.peg.2751 Staphylococcus aureus A8796 FIG   Phage protein
fig|553577.3.peg.2970 Staphylococcus aureus A8796 FIG   Phage protein
fig|553580.3.peg.2779 Staphylococcus aureus A8819 FIG   Phage protein
fig|553580.3.peg.2834 Staphylococcus aureus A8819 FIG   Phage protein
fig|553580.3.peg.2901 Staphylococcus aureus A8819 FIG   Phage protein
fig|553588.3.peg.1448 Staphylococcus aureus A9719 FIG   Phage protein
fig|553592.3.peg.1973 Staphylococcus aureus A9763 FIG   Phage protein
fig|553596.3.peg.221 Staphylococcus aureus A9781 FIG   Phage protein
fig|553601.3.peg.2182 Staphylococcus aureus A10102 FIG   Phage protein
fig|703339.3.peg.1979 Staphylococcus aureus 04-02981 FIG   Phage protein
gb|ABQ49818.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_2034
gb|ABR52901.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEV25675.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV64076.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67300.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV81632.1 Staphylococcus aureus A6224     conserved hypothetical protein
gi|13701772 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein
gi|147741520 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_2034
gi|148268451 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_2034
gi|149946965 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150394513 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_2071
gi|15927553 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1787
gi|253314996 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_02247
gi|257787335 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257793363 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257839606 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842879 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257858762 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258413653 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421132 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258447966 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|30043965 Staphylococcus phage phiN315 NCBI   hypothetical protein SA1787
img|637093502 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|638299511 Staphylococcus phage phiN315 IMG   hypothetical protein
img|639108318 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640566410 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640780174 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
kegg|sah:SaurJH1_2071 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_2034 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sau:SA1787   KEGG   hypothetical protein
ref|NP_375086.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1787
ref|NP_835542.1 Staphylococcus phage phiN315 RefSeq   hypothetical protein SA1787
ref|YP_001247394.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_2034
ref|YP_001317188.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_2071
ref|ZP_04838209.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_02247
ref|ZP_05642342.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05681927.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684060.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05696099.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
tr|A5IUE5 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6U383 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|Q99SR4 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA1787


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search