The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1788: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
Translate Function Assignments



Context on contig NC_002745 from base 1887575 to 1898861 (11287 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1782 1887575 1888078 504 +       2: 3 5 dlit(14726534)
dlit(11160124)
dlit(16177293)
Heme-degrading monooxygenase, signal transduction protein TRAP # target of RNAIII-activating protein gene_name|TRAP, locus|SA1653, protein_id|NP_374942.1, gi|15927409, geneID|1124504
1783 1889425 1888202 1224 - 123 11 1: 2   ABC transporter, permease protein EscB locus|SA1654, protein_id|NP_374943.1, gi|15927410, geneID|1124505
1784 1890158 1889418 741 - -8 10 1: 2   ABC transporter, ATP-binding protein EcsA locus|SA1655, protein_id|NP_374944.1, gi|15927411, geneID|1124506
1785 1890292 1890714 423 + 133 10 1: 1   Histidine triad (HIT) nucleotide-binding protein, similarity with At5g48545 and yeast YDL125C (HNT1) gene_name|hit, locus|SA1656, protein_id|NP_374945.1, gi|15927412, geneID|1124507
1786 1890856 1891221 366 + 141     2: 2 1   Hypothetical protein SAV1839 locus|SA1657, protein_id|NP_374946.1, gi|15927413, geneID|1124508
1787 1891956 1892513 558 + 734     1: 1   Hypothetical protein SAV1840 locus|SA1658, protein_id|NP_374947.1, gi|15927414, geneID|1124509
1788 1892718 1893680 963 + 204   3: 6 2 1   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion gene_name|prsA, locus|SA1659, protein_id|NP_374948.1, gi|15927415, geneID|1124510
1789 1894742 1893801 942 - 120 10     3'->5' exoribonuclease Bsu YhaM gene_name|cbf1, locus|SA1660, protein_id|NP_374949.1, gi|15927416, geneID|1124511
1790 1897675 1894739 2937 - -4 8   dlit(9006021) Plasmid replication DNA element cmp binding-factor 1 locus|SA1661, protein_id|NP_374950.1, gi|15927417, geneID|1124512
1791 1898861 1897665 1197 - -11 7 1: 4   DNA repair exonuclease family protein YhaO locus|SA1662, protein_id|NP_374951.1, gi|15927418, geneID|1124513

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
EcsAB_transporter_affecting_expression_and_secretion_of_secretory_preproteins SvetaG Foldase protein PrsA precursor (EC 5.2.1.8)
CBSS-176279.3.peg.1262 natapili Foldase clustered with pyrimidine conversion
Peptidyl-prolyl_cis-trans_isomerase gjo Foldase protein PrsA precursor (EC 5.2.1.8)


  Protein Sequence

>fig|158879.11.peg.1788 Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
MKMINKLIVPVTASALLLGACGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASF
TEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAA
YHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKD
PSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHI
IKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDAYKDLLKEYDVDFKDRDIKSVVEDKI
LNPEKLKQGGAQGGQSGMSQ

MD5 = 88a17fa6a2997e86864b36de7a5f090d


  DNA Sequence

>fig|158879.11.peg.1788 Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
atgaagatgataaacaaattaatcgttccggtaacagctagtgctttattattaggcgct
tgtggcgctagtgccacagactctaaagaaaatacattaatttcttctaaagctggagat
gtaacagttgcagatacaatgaaaaaaatcggtaaagatcaaattgcaaatgcatcattt
actgaaatgttaaataaaattttagctgataaatataaaaataaagttaatgataagaag
attgacgaacaaattgaaaaaatgcaaaagcaatacggcggtaaagataaatttgaaaag
gcccttcaacagcaaggtttaacagccgataaatataaagaaaatttacgtactgctgct
tatcataaagaattactatcagataaaattaaaatctctgattctgaaattaaagaagac
agcaagaaagcttcacacattttaattaaagttaaatctaagaaaagcgacaaagaaggc
ttagacgataaagaagcgaaacaaaaagctgaagaaattcaaaaagaagtttcaaaagat
ccaagtaaatttggtgaaatcgctaaaaaagaatcaatggatactggttcagctaaaaaa
gatggcgaattaggttatgttcttaaaggacaaactgataaagattttgaaaaagcacta
tttaagcttaaagatggtgaagtatcagaggttgttaaatcaagctttggatatcatatt
attaaagctgataaaccaacagactttaacagtgaaaaacaaagcctgaaagaaaaatta
gtcgatcagaaagtacaaaaaaatccaaaattattaactgatgcatacaaagatctatta
aaagaatacgatgttgactttaaagatcgtgatattaaatcagttgtcgaagataaaatc
ttaaaccctgaaaaacttaaacaaggtggcgcacaaggcggacaatccggcatgagccaa
taa


  DNA with Flanking Sequence

>fig|158879.11.peg.1788 Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
gaaaatggcttatattctataatacctacgtcaatcaacctgtacacaaattttattttt
gcattaacttaatattgccgttaattatcttatctgcaatgttcgtttatctaacaattt
cattcccgcaatatggacattattttatgttcttattggcattgaatttcggtatttcca
ttacagatttattatatttaaaaataattatattttctaattatggacaatatatagaag
aacatagtacaggtattaatattttgaaaaaaattaaaaatccatatcatttataacaaa
ataattatagcaaggtgttattatttgtttttaggctatgtaatagcttacaatcaaatg
tatatagaccttgtttttttattttcatcaatttctacccctaaacctaatgctctagtc
tgatgtcatgggttattgattggtgataatataaaactatgttatattcacgatgattaa
cttacaaaggagtttcaactatgaagatgataaacaaattaatcgttccggtaacagcta
gtgctttattattaggcgcttgtggcgctagtgccacagactctaaagaaaatacattaa
tttcttctaaagctggagatgtaacagttgcagatacaatgaaaaaaatcggtaaagatc
aaattgcaaatgcatcatttactgaaatgttaaataaaattttagctgataaatataaaa
ataaagttaatgataagaagattgacgaacaaattgaaaaaatgcaaaagcaatacggcg
gtaaagataaatttgaaaaggcccttcaacagcaaggtttaacagccgataaatataaag
aaaatttacgtactgctgcttatcataaagaattactatcagataaaattaaaatctctg
attctgaaattaaagaagacagcaagaaagcttcacacattttaattaaagttaaatcta
agaaaagcgacaaagaaggcttagacgataaagaagcgaaacaaaaagctgaagaaattc
aaaaagaagtttcaaaagatccaagtaaatttggtgaaatcgctaaaaaagaatcaatgg
atactggttcagctaaaaaagatggcgaattaggttatgttcttaaaggacaaactgata
aagattttgaaaaagcactatttaagcttaaagatggtgaagtatcagaggttgttaaat
caagctttggatatcatattattaaagctgataaaccaacagactttaacagtgaaaaac
aaagcctgaaagaaaaattagtcgatcagaaagtacaaaaaaatccaaaattattaactg
atgcatacaaagatctattaaaagaatacgatgttgactttaaagatcgtgatattaaat
cagttgtcgaagataaaatcttaaaccctgaaaaacttaaacaaggtggcgcacaaggcg
gacaatccggcatgagccaataacacaaaaccgagcgaccgtggttcaaaaatcatacca
cggccgctcggttttttcgcattaaaaatcggacagaggagctcatgtttcagtatactc
atctgtccgatatcttttaattcttaatcgagtgattcaggattgtagaatctacgattt
tcaagaccaaatattttatctgtaaactgacccttgtcagtttttttataagccttttca
aacatattcattctagcatcgatgttatcgatatagcataaaatttctgcttcttttaag
tatggcagttttggcgaaccatactctaacttaccatgatgagataaaatcatatgtctt
aacaacatgatttcttctccttcaatgttcaattcacgagctgcttcaactacttcatca
ctcgcaatcgagatgtgtcctaataagttaccttcgactgtatacgacgtcgcaacagga
ccactcaattctctaactttaccaatatcatgcaaaataatac


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0003755       F:peptidyl-prolyl cis-trans isomerase activity
GO:0005886       C:plasma membrane
GO:0006457       P:protein folding
cmr|NT01SA1815 Staphylococcus aureus N315     1WM:DIFRO
cmr|NT02SA1820 Staphylococcus aureus Mu50     prsA
cmr|NT03SA1929 Staphylococcus aureus MW2     protease maturation protein
cmr|NT05SA1758 Staphylococcus aureus NCTC 8325     foldase protein PrsA
cmr|NT09SA1753 Staphylococcus aureus subsp. aureus MSSA476     Foldase protein prsA precursor
cmr|SACOL1897 Staphylococcus aureus subsp. aureus COL     protein export protein PrsA, putative
cmr|SAUSA300_1790 Staphylococcus aureus subsp. aureus USA300-FPR3757     foldase protein PrsA precursor
dbj|BAB42927.1 Staphylococcus aureus subsp. aureus N315     prsA
dbj|BAB58003.1 Staphylococcus aureus subsp. aureus Mu50     peptidyl-prolyl cis/trans isomerase
dbj|BAB95647.1 Staphylococcus aureus subsp. aureus MW2     prsA
dbj|BAF68005.1 Staphylococcus aureus subsp. aureus str. Newman     peptidyl-prolyl cis/trans-isomerase
dbj|BAF78709.1 Staphylococcus aureus subsp. aureus Mu3     peptidyl-prolyl cis/trans isomerase
emb|CAG43567.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative peptidyl-prolyl cis-isomerase
fig|158878.1.peg.1841 Staphylococcus aureus subsp. aureus Mu50 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|158878.14.peg.1903 Staphylococcus aureus subsp. aureus Mu50 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|158879.1.peg.1710 Staphylococcus aureus subsp. aureus N315 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|196620.1.peg.1782 Staphylococcus aureus subsp. aureus MW2 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|196620.5.peg.1853 Staphylococcus aureus subsp. aureus MW2 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|282459.1.peg.1746 Staphylococcus aureus subsp. aureus MSSA476 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|282459.5.peg.1834 Staphylococcus aureus subsp. aureus MSSA476 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|359787.11.peg.1975 Staphylococcus aureus subsp. aureus JH1 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|359787.3.peg.196 Staphylococcus aureus subsp. aureus JH1 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|367830.3.peg.1580 Staphylococcus aureus subsp. aureus USA300 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|418127.4.peg.1696 Staphylococcus aureus subsp. aureus Mu3 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|418127.6.peg.1877 Staphylococcus aureus subsp. aureus Mu3 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|426430.6.peg.1677 Staphylococcus aureus subsp. aureus str. Newman FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|426430.8.peg.1875 Staphylococcus aureus subsp. aureus str. Newman FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|450394.6.peg.1098 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|451515.3.peg.1943 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|451516.9.peg.1932 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|452948.4.peg.1880 Staphylococcus aureus 930918-3 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|455227.3.peg.2253 Staphylococcus aureus D30 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|505321.3.peg.631 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|546342.3.peg.1281 Staphylococcus aureus subsp. aureus str. JKD6008 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|546343.3.peg.2231 Staphylococcus aureus subsp. aureus str. JKD6009 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|548475.3.peg.828 Staphylococcus aureus subsp. aureus TCH70 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553565.3.peg.93 Staphylococcus aureus A5937 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553567.3.peg.2166 Staphylococcus aureus A5948 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553568.3.peg.517 Staphylococcus aureus A6224 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553571.3.peg.2360 Staphylococcus aureus A6300 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553573.3.peg.1674 Staphylococcus aureus A8115 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553574.3.peg.2439 Staphylococcus aureus A8117 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553577.3.peg.993 Staphylococcus aureus A8796 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553580.3.peg.1295 Staphylococcus aureus A8819 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553581.3.peg.1778 Staphylococcus aureus A9299 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553588.3.peg.1080 Staphylococcus aureus A9719 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553590.4.peg.2323 Staphylococcus aureus A9754 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553592.3.peg.2054 Staphylococcus aureus A9763 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553594.3.peg.1775 Staphylococcus aureus A9765 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553596.3.peg.667 Staphylococcus aureus A9781 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|553601.3.peg.2017 Staphylococcus aureus A10102 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|585891.3.peg.1900 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|644279.4.peg.1989 Staphylococcus aureus subsp. aureus 132 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|680649.3.peg.1377 Staphylococcus aureus subsp. aureus MR1 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|681288.4.peg.1857 Staphylococcus aureus subsp. aureus ED98 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|703339.3.peg.1834 Staphylococcus aureus 04-02981 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|762962.3.peg.19 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|93061.3.peg.1861 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|93061.5.peg.1794 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|93062.19.peg.1854 Staphylococcus aureus subsp. aureus COL FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
fig|93062.4.peg.555 Staphylococcus aureus subsp. aureus COL FIG   Foldase protein PrsA (EC 5.2.1.8) @ Foldase clustered with pyrimidine conversion
gb|AAW36910.1 Staphylococcus aureus subsp. aureus COL     protein export protein PrsA, putative
gb|ABD22844.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     foldase protein PrsA precursor
gb|ABD31031.1 Staphylococcus aureus subsp. aureus NCTC 8325     protein export protein PrsA, putative
gb|ABR52762.1 Staphylococcus aureus subsp. aureus JH1     PpiC-type peptidyl-prolyl cis-trans isomerase
gb|ABX29836.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     peptidylprolyl isomerase
gb|EES54315.1 Staphylococcus aureus subsp. aureus TCH70     peptidyl-prolyl cis/trans isomerase
gb|EES92507.1 Staphylococcus aureus subsp. aureus USA300_TCH959     peptidyl-prolyl cis/trans isomerase
gb|EEV26112.1 Staphylococcus aureus A9781     peptidyl-prolyl cis/trans isomerase
gb|EEV63995.1 Staphylococcus aureus A9763     peptidyl-prolyl cis/trans isomerase
gb|EEV67770.1 Staphylococcus aureus A9719     foldase prsA
gb|EEV72452.1 Staphylococcus aureus A9299     peptidyl-prolyl cis/trans-isomerase
gb|EEV75211.1 Staphylococcus aureus A8115     peptidyl-prolyl cis/trans isomerase
gb|EEV76860.1 Staphylococcus aureus A6300     peptidylprolyl isomerase
gb|EEV81315.1 Staphylococcus aureus A6224     peptidyl-prolyl cis/trans-isomerase
gb|EEV82493.1 Staphylococcus aureus A5948     foldase prsA
gb|EEV87204.1 Staphylococcus aureus A5937     foldase prsA
gb|EEW44469.1 Staphylococcus aureus 930918-3     hypothetical protein SA930_0804
gi|122540695 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|123485269 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|13701634 Staphylococcus aureus subsp. aureus N315 NCBI   prsA
gi|14247613 Staphylococcus aureus subsp. aureus Mu50 NCBI   peptidyl-prolyl cis/trans isomerase
gi|149946826 Staphylococcus aureus subsp. aureus JH1 NCBI   PpiC-type peptidyl-prolyl cis-trans isomerase
gi|150374745 Staphylococcus aureus subsp. aureus str. Newman NCBI   peptidyl-prolyl cis/trans-isomerase
gi|150394374 Staphylococcus aureus subsp. aureus JH1 NCBI   PpiC-type peptidyl-prolyl cis-trans isomerase
gi|151221945 Staphylococcus aureus subsp. aureus str. Newman NCBI   peptidyl-prolyl cis/trans-isomerase
gi|156722292 Staphylococcus aureus subsp. aureus Mu3 NCBI   peptidyl-prolyl cis/trans isomerase
gi|156980157 Staphylococcus aureus subsp. aureus Mu3 NCBI   peptidyl-prolyl cis/trans isomerase
gi|15924831 Staphylococcus aureus subsp. aureus Mu50 NCBI   peptidyl-prolyl cis/trans isomerase
gi|15927415 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1659
gi|160368865 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   peptidylprolyl isomerase
gi|161510056 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   peptidylprolyl isomerase
gi|189037914 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|189037915 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|189037916 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|189037917 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|21204952 Staphylococcus aureus subsp. aureus MW2 NCBI   prsA
gi|21283511 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1782
gi|221138269 Staphylococcus aureus subsp. aureus str. JKD6008 NCBI   peptidylprolyl isomerase
gi|221142176 Staphylococcus aureus subsp. aureus str. JKD6009 NCBI   peptidylprolyl isomerase
gi|251801658 Staphylococcus aureus subsp. aureus TCH70 NCBI   peptidyl-prolyl cis/trans isomerase
gi|251814834 Staphylococcus aureus subsp. aureus TCH70 NCBI   peptidyl-prolyl cis/trans isomerase
gi|253315172 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   foldase protein PrsA precursor
gi|253723778 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   peptidyl-prolyl cis/trans isomerase
gi|253732497 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   peptidyl-prolyl cis/trans isomerase
gi|255006629 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   foldase protein PrsA precursor
gi|257787772 Staphylococcus aureus A9781 NCBI   peptidyl-prolyl cis/trans isomerase
gi|257793800 Staphylococcus aureus A9781 NCBI   peptidyl-prolyl cis/trans isomerase
gi|257839524 Staphylococcus aureus A9763 NCBI   peptidyl-prolyl cis/trans isomerase
gi|257843360 Staphylococcus aureus A9719 NCBI   foldase prsA
gi|257848461 Staphylococcus aureus A9299 NCBI   peptidyl-prolyl cis/trans-isomerase
gi|257851268 Staphylococcus aureus A8115 NCBI   peptidyl-prolyl cis/trans isomerase
gi|257853904 Staphylococcus aureus A6300 NCBI   peptidylprolyl isomerase
gi|257858439 Staphylococcus aureus A6224 NCBI   peptidyl-prolyl cis/trans-isomerase
gi|257859644 Staphylococcus aureus A5948 NCBI   foldase prsA
gi|257864459 Staphylococcus aureus A5937 NCBI   foldase prsA
gi|258413737 Staphylococcus aureus A9763 NCBI   peptidyl-prolyl cis/trans isomerase
gi|258420756 Staphylococcus aureus A9719 NCBI   foldase prsA
gi|258438417 Staphylococcus aureus A9299 NCBI   peptidyl-prolyl cis/trans-isomerase
gi|258443862 Staphylococcus aureus A8115 NCBI   peptidyl-prolyl cis/trans isomerase
gi|258447317 Staphylococcus aureus A6300 NCBI   peptidylprolyl isomerase
gi|258448200 Staphylococcus aureus A6224 NCBI   peptidyl-prolyl cis/trans-isomerase
gi|258452669 Staphylococcus aureus A5948 NCBI   foldase prsA
gi|258453367 Staphylococcus aureus A5937 NCBI   foldase prsA
gi|259159417 Staphylococcus aureus 930918-3 NCBI   hypothetical protein SA930_0804
gi|46396696 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|46396697 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|46396698 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|49245101 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative peptidyl-prolyl cis-isomerase
gi|49486658 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative peptidyl-prolyl cis-isomerase
gi|56749190 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|57284816 Staphylococcus aureus subsp. aureus COL NCBI   protein export protein PrsA, putative
gi|57650630 Staphylococcus aureus subsp. aureus COL NCBI   protein export protein PrsA, putative
gi|81694206 organism not parsed/found in ncbi nr NCBI   RecName: Full=Foldase protein prsA; Flags: Precursor
gi|87128330 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   foldase protein PrsA precursor
gi|87162356 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   foldase protein PrsA precursor
gi|87203221 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   protein export protein PrsA, putative
gi|88195663 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   protein export protein PrsA, putative
img|637093333 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100356 Staphylococcus aureus aureus Mu50 IMG   peptidyl-prolyl cis/trans isomerase
img|637152631 Staphylococcus aureus aureus COL IMG   protein export protein PrsA, putative
img|637157991 Staphylococcus aureus aureus MSSA476 IMG   putative peptidyl-prolyl cis-isomerase
img|637299554 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|637888436 Staphylococcus aureus aureus USA300 IMG   foldase protein PrsA precursor( EC:5.2.1.8 )
img|637894571 Staphylococcus aureus aureus NCTC 8325 IMG   protein export protein PrsA, putative
img|639108633 Staphylococcus aureus aureus JH1 IMG   PpiC-type peptidyl-prolyl cis-trans isomerase
img|640780004 Staphylococcus aureus aureus JH1 IMG   PpiC-type peptidyl-prolyl cis-trans isomerase
img|640796122 Staphylococcus aureus aureus Newman IMG   peptidyl-prolyl cis/trans-isomerase
img|640904578 Staphylococcus aureus aureus Mu3 IMG   peptidyl-prolyl cis/trans isomerase
img|641309801 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   peptidylprolyl isomerase( EC:5.2.1.8 )
img|641771338 Staphylococcus aureus aureus USA300_TCH959 IMG   peptidylprolyl isomerase
kegg|saa:SAUSA300_1790 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   foldase protein PrsA precursor (EC:5.2.1.8)
kegg|sac:SACOL1897 Staphylococcus aureus subsp. aureus COL KEGG   protein export protein PrsA, putative
kegg|sae:NWMN_1733 Staphylococcus aureus subsp. aureus Newman KEGG   peptidyl-prolyl cis/trans-isomerase
kegg|sah:SaurJH1_1928 Staphylococcus aureus subsp. aureus JH1 KEGG   PpiC-type peptidyl-prolyl cis-trans isomerase
kegg|sam:MW1782 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sao:SAOUHSC_01972 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   protein export protein PrsA, putative
kegg|sas:SAS1762   KEGG   putative peptidyl-prolyl cis-isomerase
kegg|sau:SA1659   KEGG   hypothetical protein
kegg|sav:SAV1841   KEGG   peptidyl-prolyl cis/trans isomerase
kegg|saw:SAHV_1826 Staphylococcus aureus subsp. aureus Mu3 KEGG   peptidyl-prolyl cis-trans isomerase
kegg|sax:USA300HOU_1833 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   peptidylprolyl isomerase (EC:5.2.1.8)
ref|NP_372365.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|NP_374948.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1659
ref|NP_646599.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1782
ref|YP_001317049.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   PpiC-type peptidyl-prolyl cis-trans isomerase
ref|YP_001332767.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   peptidyl-prolyl cis/trans-isomerase
ref|YP_001442416.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|YP_001575715.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   peptidylprolyl isomerase
ref|YP_043879.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   putative peptidyl-prolyl cis-isomerase
ref|YP_186723.1 Staphylococcus aureus subsp. aureus COL RefSeq   protein export protein PrsA, putative
ref|YP_494473.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   foldase protein PrsA precursor
ref|YP_500469.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   protein export protein PrsA, putative
ref|ZP_03563071.1 Staphylococcus aureus subsp. aureus str. JKD6008 RefSeq   peptidylprolyl isomerase
ref|ZP_03566669.1 Staphylococcus aureus subsp. aureus str. JKD6009 RefSeq   peptidylprolyl isomerase
ref|ZP_04829307.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|ZP_04838385.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   foldase protein PrsA precursor
ref|ZP_04866662.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|ZP_05145230.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   foldase protein PrsA precursor
ref|ZP_05642779.1 Staphylococcus aureus A9781 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|ZP_05682010.1 Staphylococcus aureus A9763 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|ZP_05683695.1 Staphylococcus aureus A9719 RefSeq   foldase prsA
ref|ZP_05689701.1 Staphylococcus aureus A9299 RefSeq   peptidyl-prolyl cis/trans-isomerase
ref|ZP_05692201.1 Staphylococcus aureus A8115 RefSeq   peptidyl-prolyl cis/trans isomerase
ref|ZP_05695464.1 Staphylococcus aureus A6300 RefSeq   peptidylprolyl isomerase
ref|ZP_05696327.1 Staphylococcus aureus A6224 RefSeq   peptidyl-prolyl cis/trans-isomerase
ref|ZP_05700668.1 Staphylococcus aureus A5948 RefSeq   foldase prsA
ref|ZP_05701350.1 Staphylococcus aureus A5937 RefSeq   foldase prsA
sp|A6QI23 Staphylococcus aureus (strain Newman) SwissProt   Foldase protein prsA precursor
sp|A6U2U4 Staphylococcus aureus (strain JH1) SwissProt   Foldase protein prsA precursor
sp|A7X3U8 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   Foldase protein prsA precursor
sp|A8YY10 Staphylococcus aureus (strain USA300 / TCH1516) SwissProt   Foldase protein prsA precursor
sp|P60747 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Foldase protein prsA precursor
sp|P60748 Staphylococcus aureus (strain N315) SwissProt   Foldase protein prsA precursor
sp|P60749 Staphylococcus aureus (strain MW2) SwissProt   Foldase protein prsA precursor
sp|PRSA_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAA2 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAA3 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAA8 organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAC organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAE organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAS organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAT organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|PRSA_STAAW organism not parsed/found in ncbi nr SwissProt   RecName: Full=Foldase protein prsA; Flags: Precursor
sp|Q2FFQ5 Staphylococcus aureus (strain USA300) SwissProt   Foldase protein prsA precursor
sp|Q2G2S6 Staphylococcus aureus (strain NCTC 8325) SwissProt   Foldase protein prsA precursor
sp|Q5HET4 Staphylococcus aureus (strain COL) SwissProt   Foldase protein prsA precursor
sp|Q6G894 Staphylococcus aureus (strain MSSA476) SwissProt   Foldase protein prsA precursor
tr|C5N6S0 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Peptidyl-prolyl cis/trans isomerase
tr|C5QKJ1 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Peptidyl-prolyl cis/trans isomerase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
11 fig|158879.11.peg.1783 ABC transporter, permease protein EscB
10 fig|158879.11.peg.1784 ABC transporter, ATP-binding protein EcsA
10 fig|158879.11.peg.1785 Histidine triad (HIT) nucleotide-binding protein, similarity with At5g48545 and yeast YDL125C (HNT1)
10 fig|158879.11.peg.1789 3'->5' exoribonuclease Bsu YhaM
8 fig|158879.11.peg.1790 Plasmid replication DNA element cmp binding-factor 1
7 fig|158879.11.peg.1791 DNA repair exonuclease family protein YhaO


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search