The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1692: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
Translate Function Assignments



Context on contig NC_002745 from base 1790842 to 1805510 (14669 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1685 1794666 1790842 3825 -       5: 15 10 2 9 11   Cell division protein FtsK locus|SA1562, protein_id|NP_374851.1, gi|15927318, geneID|1124408
1686 1795283 1794687 597 - 20     1: 1   Phenylalanyl-tRNA synthetase domain protein (Bsu YtpR) locus|SA1563, protein_id|NP_374852.1, gi|15927319, geneID|1124409
1687 1796169 1795312 858 - 28     2: 6 14   UPF0354 protein YtpQ locus|SA1564, protein_id|NP_374853.1, gi|15927320, geneID|1124410
1688 1796580 1796269 312 - 99     1: 1   Thioredoxin-like protein YtpP locus|SA1565, protein_id|NP_374854.1, gi|15927321, geneID|1124411
1689 1797721 1796645 1077 - 64     3: 1 4 13   Glutamyl aminopeptidase (EC 3.4.11.7); Deblocking aminopeptidase locus|SA1566, protein_id|NP_374855.1, gi|15927322, geneID|1124412
1690 1797805 1798119 315 + 83         Hypothetical protein MW1689 locus|SA1567, protein_id|NP_374856.1, gi|15927323, geneID|1124413
1691 1799035 1798244 792 - 124         Metallo-beta-lactamase family protein locus|SA1568, protein_id|NP_374857.1, gi|15927324, geneID|1124414
1692 1800201 1799557 645 - 521         tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) locus|SA1569, protein_id|NP_374858.1, gi|15927325, geneID|1124415
1693 1801007 1800216 792 - 14         Putative phosphotransferase YtmP locus|SA1570, protein_id|NP_374859.1, gi|15927326, geneID|1124416
1694 1802405 1801557 849 - 549     3: 8 12 3   D-alanine aminotransferase (EC 2.6.1.21) locus|SA1571, protein_id|NP_374860.1, gi|15927327, geneID|1124417
1695 1803818 1802409 1410 - 3         Putative Xaa-His dipeptidase locus|SA1572, protein_id|NP_374861.1, gi|15927328, geneID|1124418
1696 1804798 1804376 423 - 557         Hypothetical protein SAV1752 locus|SA1573, protein_id|NP_374862.1, gi|15927329, geneID|1124419
1697 1805510 1804815 696 - 16     2: 5 7   SSU rRNA pseudouridine(516) synthase (EC 5.4.99.19) ## RsuA locus|SA1574, protein_id|NP_374863.1, gi|15927330, geneID|1124420

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.1692 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
MRVRYKPWAEDYLKDHPELVDMEGQHAGEMTEWFDKTQPIHIEIGSGMGQFITTLAAQNP
HINYISMEREKSIVYKVLDKVKEMGLTNLKIICNDAIELNEYFKDGEVSRIYLNFSDPWP
KNRHAKRRLTYHTFLALYQQILNDEGDLHFKTDNRGLFAYSLESMSQFGMYFTKINLNLH
QEDDGSNILTEYEKKFSDKGSRIYRMEAKFHSQK

MD5 = 5b81c02641f38b2d069a93a333382183


  DNA Sequence

>fig|158879.11.peg.1692 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
atgagagttcgatacaaaccatgggctgaagattatttaaaagatcatcctgaattggtt
gacatggaaggtcaacatgcaggggaaatgactgaatggtttgataaaacgcaaccgata
cacattgaaattggttcgggtatggggcagtttattacaacattagctgctcaaaatcct
catattaactatatttcaatggaacgtgagaaaagtatcgtttataaagtattggataaa
gttaaagagatgggtttaacaaatttaaagattatttgtaatgacgccattgaattaaat
gaatattttaaagacggcgaagtttcgcgtatttatttgaacttttcagatccatggcca
aaaaatcgtcatgcaaaacgacgtttaacgtatcatacgtttttagcgttgtatcaacaa
atcttaaatgatgaaggagatttacattttaaaactgataacagaggactatttgcctac
agtttagaaagtatgtctcaatttggaatgtattttacaaaaataaatctaaatttacat
caagaagacgatggcagtaatattttaacagaatatgaaaagaaattttcggataaaggg
tcacgtatttatcgtatggaagcgaaattccattcacaaaaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.1692 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
ttaaagcgtatggaaatggaacctattactcctgagattatgcttaataaaattaatgcc
tctttatcaagagaagttttaacacatcatattgtgagaaaatcattaacctatttagaa
gagcatataccgagtttagattcgcgttttttcactgttgtacatggtgatgtgaatcat
aataattggttattatccgatcgagatgaactatttttagttgattgggaaggtgcaatg
attgcagacccggcaattgatatcggaatgctgctttacaactatgttccacaacaacaa
tggtctgaatggcttgaaacatatggtgttcaagagagcttgaatttaaataaacgtatg
aaatggtatacggtaattcaatctataggtcttgttcaatggtatgaagagcaaaaaaga
tataaggatatgaacacttggcttaaattcctaaatgaagttatgaatagtaacatgttt
atttaagaggagaataaaatatgagagttcgatacaaaccatgggctgaagattatttaa
aagatcatcctgaattggttgacatggaaggtcaacatgcaggggaaatgactgaatggt
ttgataaaacgcaaccgatacacattgaaattggttcgggtatggggcagtttattacaa
cattagctgctcaaaatcctcatattaactatatttcaatggaacgtgagaaaagtatcg
tttataaagtattggataaagttaaagagatgggtttaacaaatttaaagattatttgta
atgacgccattgaattaaatgaatattttaaagacggcgaagtttcgcgtatttatttga
acttttcagatccatggccaaaaaatcgtcatgcaaaacgacgtttaacgtatcatacgt
ttttagcgttgtatcaacaaatcttaaatgatgaaggagatttacattttaaaactgata
acagaggactatttgcctacagtttagaaagtatgtctcaatttggaatgtattttacaa
aaataaatctaaatttacatcaagaagacgatggcagtaatattttaacagaatatgaaa
agaaattttcggataaagggtcacgtatttatcgtatggaagcgaaattccattcacaaa
aataaaacacttatgagggtatgtacacatacaatcataagtgttttttcgtactataat
ggttctatagataaaggttctataataaatcggactgatggaaaaaagtattttactttt
catctgtccgattttttgattttgaatataaaaaaagcgcaattatctctataattaaaa
gtgactaaacaaataactaaaggagataatgcgcctataaacaatgttatactaaatacc
tttgatttaaaagaataaagcttgcattttacttgtaaattttaattattaatttaaaat
tacaggccgatggttatgatgcatttacatataatatgattgcattaatctttataagta
gttagaagtgtattagtgtggggcgtttcgtttttgttcgcatttatgaatagtgatatg
atgtaataaatacatgctaattgtaataacgaatacagaaagaataggtgatgttatgaa
gatcggggatatatctattcattat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006400       P:tRNA modification
GO:0008176       F:tRNA (guanine-N7-)-methyltransferase activity
cmr|NT01SA1714 Staphylococcus aureus N315     methyltransferase, putative
cmr|NT02SA1725 Staphylococcus aureus Mu50     tRNA (guanine-N(7)-)-methyltransferase
dbj|BAB42837.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB57910.1 Staphylococcus aureus subsp. aureus Mu50     tRNA (guanine-N(7)-)-methyltransferase
dbj|BAF78617.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.1748 Staphylococcus aureus subsp. aureus Mu50 FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
fig|158878.14.peg.1804 Staphylococcus aureus subsp. aureus Mu50 FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
fig|158879.1.peg.1620 Staphylococcus aureus subsp. aureus N315 FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
fig|418127.4.peg.1615 Staphylococcus aureus subsp. aureus Mu3 FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
fig|418127.6.peg.1781 Staphylococcus aureus subsp. aureus Mu3 FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
fig|585891.3.peg.1801 Staphylococcus aureus subsp. aureus Mu50-omega FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
fig|680649.3.peg.2509 Staphylococcus aureus subsp. aureus MR1 FIG   tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33)
gi|13701543 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14247520 Staphylococcus aureus subsp. aureus Mu50 NCBI   tRNA (guanine-N(7)-)-methyltransferase
gi|156722200 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156980065 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1734
gi|15924738 Staphylococcus aureus subsp. aureus Mu50 NCBI   tRNA (guanine-N(7)-)-methyltransferase
gi|15927325 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1569
gi|226695593 organism not parsed/found in ncbi nr NCBI   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
gi|255006534 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   tRNA (guanine-N(7)-)-methyltransferase
gi|54039773 organism not parsed/found in ncbi nr NCBI   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
gi|54042296 organism not parsed/found in ncbi nr NCBI   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
img|637093240 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100256 Staphylococcus aureus aureus Mu50 IMG   tRNA (guanine-N(7)-)-methyltransferase
img|640904478 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sau:SA1569   KEGG   hypothetical protein
kegg|sav:SAV1748   KEGG   tRNA (guanine-N(7)-)-methyltransferase
kegg|saw:SAHV_1734 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372272.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   tRNA (guanine-N(7)-)-methyltransferase
ref|NP_374858.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1569
ref|YP_001442324.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1734
ref|ZP_05145135.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   tRNA (guanine-N(7)-)-methyltransferase
sp|A7X3I5 Staphylococcus aureus (strain Mu3 / ATCC 700698) SwissProt   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
sp|P67500 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
sp|P67501 Staphylococcus aureus (strain N315) SwissProt   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
sp|TRMB_STAA1 organism not parsed/found in ncbi nr SwissProt   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
sp|TRMB_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase
sp|TRMB_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; AltName: Full=tRNA(m7G46)-methyltransferase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search