The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
 The SEED


FIG search

Protein fig|158879.11.peg.166: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Inner membrane protein YbaN
Translate Function Assignments


Context on contig NC_002745 from base 178779 to 189467 (10689 bp)

Fid Start End Size
(nt)		   Gap Find
best
clusters		 Pins Fc-sc SS Ev Function Aliases
160 178779 179984 1206 +           Capsular polysaccharide synthesis enzyme CapL gene_name|capL, locus|SA0155, protein_id|NP_373397.1, gi|15925864, geneID|1122930
161 179995 180552 558 + 10         Capsular polysaccharide synthesis enzyme CapM gene_name|capM, locus|SA0156, protein_id|NP_373398.1, gi|15925865, geneID|1122931
162 180552 181439 888 + -1         Capsular polysaccharide synthesis enzyme CapN gene_name|capN, locus|SA0157, protein_id|NP_373399.1, gi|15925866, geneID|1122932
163 181493 182755 1263 + 53       dlit(21454499) UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.336) gene_name|capO, locus|SA0158, protein_id|NP_373400.1, gi|15925867, geneID|1122933
164 182832 183977 1146 + 76         Capsular polysaccharide synthesis enzyme Cap8P gene_name|capP, locus|SA0159, protein_id|NP_373401.1, gi|15925868, geneID|1122934
165 184368 184042 327 - 64     1: 1 dlit(14570922)
dlit(15520015)		 Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) # IsdI locus|SA0160, protein_id|NP_373402.1, gi|15925869, geneID|1122935
166 184758 184375 384 - 6     1: 1   Inner membrane protein YbaN locus|SA0161, protein_id|NP_373403.1, gi|15925870, geneID|1122936
167 185185 186672 1488 + 426     3: 6 2 3   Aldehyde dehydrogenase B (EC 1.2.1.22) gene_name|aldA, locus|SA0162, protein_id|NP_373404.1, gi|15925871, geneID|1122937
168 187319 188278 960 + 646     3: 5 4 7   Cobalt-zinc-cadmium resistance protein locus|SA0163, protein_id|NP_373405.1, gi|15925872, geneID|1122938
169 188407 188270 138 - -9         hypothetical protein  
170 188346 188525 180 + -62         hypothetical protein  
171 188543 188388 156 - -138         hypothetical protein locus|SAS005, protein_id|NP_373406.1, gi|15925873, geneID|1122939
172 188438 188590 153 + -106         hypothetical protein  
173 188776 188573 204 - -18         FIG01108246: hypothetical protein locus|SA0164, protein_id|NP_373407.1, gi|15925874, geneID|1122940
174 188955 189467 513 + 178         FIG01108032: hypothetical protein locus|SA0165, protein_id|NP_373408.1, gi|15925875, geneID|1122941

Annotation History   /   View All Related Annotations Help on Annotations


  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Heme,_hemin_uptake_and_utilization_systems_in_GramPositives SvetaG FIG039061: hypothetical protein related to heme utilization


  Protein Sequence

>fig|158879.11.peg.166 Inner membrane protein YbaN
MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVE
NFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPK
SNHKIEE

MD5 = 3ebc886ff3845aed712ee80666c15d65


  DNA Sequence

>fig|158879.11.peg.166 Inner membrane protein YbaN
atgcgacttattttaatcgttattggcttaatatttacagcgcttggtattgcaggtgcc
gtattacctttactgccaacgaccccttttttactcgtagcagttttttgttttgctcga
agttcagatcggttttacaattggcttattaatcaaaaaatttataaagaatatgtagaa
aacttttatttacatcgaggctacacgctacaacagaaaattaaaattttaattagctta
tacattgtaataggtttttcaatttatatggtggatgttcttgcagtccgtgtaggatta
atcataatggttatcatacaaaccgctgtactctttacatttgtaaaaacattacccaaa
tcaaatcataaaatagaggagtga


  DNA with Flanking Sequence

>fig|158879.11.peg.166 Inner membrane protein YbaN
ctacctttaacaaattccccattgataaataaaccataattctctgcaatataatctcga
acgtttactgccatattatctctcctttgtttattggctataatataaatctcttagcat
catatttaataatgcttttaaacgatatgattcacattatatagtaagcgtttacatttt
ataaaataatcagctcacagaagtctcatttttaaaacttttgcgtcgtttttgcacata
aaaataatcttattttcgaaaacatattgcacttttcaaaaataaaacacataatataac
tataatacttgagaataattctcattaaatagtttggttgttatgaaagtcgcgcttaaa
atgcgttaatgggacaagaataattcaacaacgtttcattttactgagtcattgcactta
tcatacacattatatttagcatgagttatattactaaaacaatattacatgcgcattagt
actagaatggagttttttcaatgcgacttattttaatcgttattggcttaatatttacag
cgcttggtattgcaggtgccgtattacctttactgccaacgaccccttttttactcgtag
cagttttttgttttgctcgaagttcagatcggttttacaattggcttattaatcaaaaaa
tttataaagaatatgtagaaaacttttatttacatcgaggctacacgctacaacagaaaa
ttaaaattttaattagcttatacattgtaataggtttttcaatttatatggtggatgttc
ttgcagtccgtgtaggattaatcataatggttatcatacaaaccgctgtactctttacat
ttgtaaaaacattacccaaatcaaatcataaaatagaggagtgattgcccatgtttatgg
cagaaaatagattacaattacaaaaaggcagtgcggaagaaacgattgaacgtttttaca
atagacaaggcattgaaactattgaaggcttccaacaaatgtttgtcactaaaacattaa
ataccgaggatacagacgaagttaaaatcttaactatttgggaatctgaagatagcttta
ataattggttgaattccgatgtatttaaagaagctcataaaaatgtacgtttaaaaagtg
atgacgatggacagcaaagtccaatattatcaaataaagtattcaaatatgatattggct
accactatcaaaaataaatatattaaaaacccctagtcaccgctggttgtctaaaccaac
ttcatgattaggggttttttattatttgtgacgtaaaggtacgaattcatccggcttgtc
tgagcgcaatccaaaataatattctattgcttcacaaatacgtcgtgatgcttgtccatc
acca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA0170 Staphylococcus aureus N315     Unknown
cmr|NT02SA0163 Staphylococcus aureus Mu50     Protein of unknown function (DUF454) family
cmr|NT05SA0118 Staphylococcus aureus NCTC 8325     protein of unknown function
cmr|SACOL0153 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
cmr|SAUSA300_0169 Staphylococcus aureus subsp. aureus USA300-FPR3757     conserved hypothetical protein
dbj|BAB41381.1 Staphylococcus aureus subsp. aureus N315     conserved hypothetical protein
dbj|BAB56328.1 Staphylococcus aureus subsp. aureus Mu50     conserved hypothetical protein
dbj|BAF66384.1 Staphylococcus aureus subsp. aureus str. Newman     conserved hypothetical protein
dbj|BAF77048.1 Staphylococcus aureus subsp. aureus Mu3     conserved hypothetical protein
fig|158878.1.peg.166 Staphylococcus aureus subsp. aureus Mu50 FIG   Inner membrane protein YbaN
fig|158878.14.peg.164 Staphylococcus aureus subsp. aureus Mu50 FIG   Inner membrane protein YbaN
fig|158879.1.peg.164 Staphylococcus aureus subsp. aureus N315 FIG   Inner membrane protein YbaN
fig|359786.13.peg.192 Staphylococcus aureus subsp. aureus JH9 FIG   Inner membrane protein YbaN
fig|359786.3.peg.1127 Staphylococcus aureus subsp. aureus JH9 FIG   Inner membrane protein YbaN
fig|359787.3.peg.2036 Staphylococcus aureus subsp. aureus JH1 FIG   Inner membrane protein YbaN
fig|367830.3.peg.1459 Staphylococcus aureus subsp. aureus USA300 FIG   Inner membrane protein YbaN
fig|426430.8.peg.121 Staphylococcus aureus subsp. aureus str. Newman FIG   Inner membrane protein YbaN
fig|451515.3.peg.228 Staphylococcus aureus subsp. aureus USA300_FPR3757 FIG   Inner membrane protein YbaN
fig|451516.9.peg.217 Staphylococcus aureus subsp. aureus USA300_TCH1516 FIG   Inner membrane protein YbaN
fig|455227.3.peg.182 Staphylococcus aureus D30 FIG   Inner membrane protein YbaN
fig|505321.3.peg.1835 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Inner membrane protein YbaN
fig|553565.3.peg.2484 Staphylococcus aureus A5937 FIG   Inner membrane protein YbaN
fig|553567.3.peg.1093 Staphylococcus aureus A5948 FIG   Inner membrane protein YbaN
fig|553568.3.peg.799 Staphylococcus aureus A6224 FIG   Inner membrane protein YbaN
fig|553571.3.peg.2069 Staphylococcus aureus A6300 FIG   Inner membrane protein YbaN
fig|553573.3.peg.1960 Staphylococcus aureus A8115 FIG   Inner membrane protein YbaN
fig|553574.3.peg.1725 Staphylococcus aureus A8117 FIG   Inner membrane protein YbaN
fig|553577.3.peg.840 Staphylococcus aureus A8796 FIG   Inner membrane protein YbaN
fig|553580.3.peg.576 Staphylococcus aureus A8819 FIG   Inner membrane protein YbaN
fig|553581.3.peg.2091 Staphylococcus aureus A9299 FIG   Inner membrane protein YbaN
fig|553588.3.peg.1477 Staphylococcus aureus A9719 FIG   Inner membrane protein YbaN
fig|553590.4.peg.1171 Staphylococcus aureus A9754 FIG   Inner membrane protein YbaN
fig|553592.3.peg.854 Staphylococcus aureus A9763 FIG   Inner membrane protein YbaN
fig|553594.3.peg.830 Staphylococcus aureus A9765 FIG   Inner membrane protein YbaN
fig|553601.3.peg.29 Staphylococcus aureus A10102 FIG   Inner membrane protein YbaN
fig|585891.3.peg.164 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Inner membrane protein YbaN
fig|644279.4.peg.238 Staphylococcus aureus subsp. aureus 132 FIG   Inner membrane protein YbaN
fig|680649.3.peg.1638 Staphylococcus aureus subsp. aureus MR1 FIG   Inner membrane protein YbaN
fig|681288.4.peg.133 Staphylococcus aureus subsp. aureus ED98 FIG   Inner membrane protein YbaN
fig|703339.3.peg.167 Staphylococcus aureus 04-02981 FIG   Inner membrane protein YbaN
fig|93061.3.peg.144 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Inner membrane protein YbaN
fig|93061.5.peg.123 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   Inner membrane protein YbaN
fig|93062.4.peg.620 Staphylococcus aureus subsp. aureus COL FIG   Inner membrane protein YbaN
gb|AAW37450.1 Staphylococcus aureus subsp. aureus COL     conserved hypothetical protein
gb|ABD22737.1 Staphylococcus aureus subsp. aureus USA300_FPR3757     conserved hypothetical protein
gb|ABD29312.1 Staphylococcus aureus subsp. aureus NCTC 8325     conserved hypothetical protein
gb|ABQ47959.1 Staphylococcus aureus subsp. aureus JH9     protein of unknown function DUF454
gb|ABR51019.1 Staphylococcus aureus subsp. aureus JH1     protein of unknown function DUF454
gb|ABX28212.1 Staphylococcus aureus subsp. aureus USA300_TCH1516     hypothetical membrane protein
gb|EEV26331.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV65041.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67009.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV71785.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74355.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV76993.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV81004.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV83474.1 Staphylococcus aureus A5948     conserved hypothetical protein
gb|EEV84703.1 Staphylococcus aureus A5937     conserved hypothetical protein
gb|EEW48125.1 Staphylococcus aureus D30     hypothetical protein SAD30_1680
gi|13700082 Staphylococcus aureus subsp. aureus N315 NCBI   conserved hypothetical protein
gi|14245933 Staphylococcus aureus subsp. aureus Mu50 NCBI   conserved hypothetical protein
gi|147739661 Staphylococcus aureus subsp. aureus JH9 NCBI   protein of unknown function DUF454
gi|148266592 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_0152
gi|149945083 Staphylococcus aureus subsp. aureus JH1 NCBI   protein of unknown function DUF454
gi|150373124 Staphylococcus aureus subsp. aureus str. Newman NCBI   conserved hypothetical protein
gi|150392631 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_0157
gi|151220324 Staphylococcus aureus subsp. aureus str. Newman NCBI   hypothetical protein NWMN_0112
gi|156720631 Staphylococcus aureus subsp. aureus Mu3 NCBI   conserved hypothetical protein
gi|156978496 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0165
gi|15923156 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0166
gi|15925870 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0161
gi|160367241 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical membrane protein
gi|161508432 Staphylococcus aureus subsp. aureus USA300_TCH1516 NCBI   hypothetical protein USA300HOU_0180
gi|253316302 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_09211
gi|255004963 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00800
gi|257787991 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257794019 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257840582 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257842587 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257847789 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850407 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854040 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257858116 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257860652 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|257861930 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258408573 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258421163 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258438913 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444148 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447027 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258448485 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258451604 Staphylococcus aureus A5948 NCBI   conserved hypothetical protein
gi|258455718 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|259163569 Staphylococcus aureus D30 NCBI   hypothetical protein SAD30_1680
gi|57285356 Staphylococcus aureus subsp. aureus COL NCBI   conserved hypothetical protein
gi|57651170 Staphylococcus aureus subsp. aureus COL NCBI   hypothetical protein SACOL0153
gi|87128223 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   conserved hypothetical protein
gi|87162249 Staphylococcus aureus subsp. aureus USA300_FPR3757 NCBI   hypothetical protein SAUSA300_0169
gi|87201502 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   conserved hypothetical protein
gi|88193944 Staphylococcus aureus subsp. aureus NCTC 8325 NCBI   hypothetical protein SAOUHSC_00131
img|637091761 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098665 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637150936 Staphylococcus aureus aureus COL IMG   hypothetical protein
img|637886824 Staphylococcus aureus aureus USA300 IMG   hypothetical protein
img|637892805 Staphylococcus aureus aureus NCTC 8325 IMG   hypothetical protein
img|639108488 Staphylococcus aureus aureus JH1 IMG   Protein of unknown function DUF454
img|640564482 Staphylococcus aureus aureus JH9 IMG   protein of unknown function DUF454
img|640778227 Staphylococcus aureus aureus JH1 IMG   protein of unknown function DUF454
img|640794472 Staphylococcus aureus aureus Newman IMG   hypothetical protein
img|640902887 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
img|641308140 Staphylococcus aureus subsp. aureus USA300_TCH1516 IMG   hypothetical membrane protein
img|641771886 Staphylococcus aureus aureus USA300_TCH959 IMG   hypothetical membrane protein
kegg|saa:SAUSA300_0169 Staphylococcus aureus subsp. aureus USA300_FPR3757 KEGG   hypothetical protein
kegg|sac:SACOL0153 Staphylococcus aureus subsp. aureus COL KEGG   hypothetical protein
kegg|sae:NWMN_0112 Staphylococcus aureus subsp. aureus Newman KEGG   hypothetical protein
kegg|sah:SaurJH1_0157 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_0152 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sao:SAOUHSC_00131 Staphylococcus aureus subsp. aureus NCTC 8325 KEGG   hypothetical protein
kegg|sau:SA0161   KEGG   hypothetical protein
kegg|sav:SAV0166   KEGG   hypothetical protein
kegg|saw:SAHV_0165 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
kegg|sax:USA300HOU_0180 Staphylococcus aureus subsp. aureus USA300_TCH1516 KEGG   hypothetical protein
ref|NP_370690.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0166
ref|NP_373403.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0161
ref|YP_001245535.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_0152
ref|YP_001315306.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_0157
ref|YP_001331147.1 Staphylococcus aureus subsp. aureus str. Newman RefSeq   hypothetical protein NWMN_0112
ref|YP_001440755.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0165
ref|YP_001574091.1 Staphylococcus aureus subsp. aureus USA300_TCH1516 RefSeq   hypothetical protein USA300HOU_0180
ref|YP_185053.1 Staphylococcus aureus subsp. aureus COL RefSeq   hypothetical protein SACOL0153
ref|YP_492883.1 Staphylococcus aureus subsp. aureus USA300_FPR3757 RefSeq   hypothetical protein SAUSA300_0169
ref|YP_498731.1 Staphylococcus aureus subsp. aureus NCTC 8325 RefSeq   hypothetical protein SAOUHSC_00131
ref|ZP_04839515.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_09211
ref|ZP_05143564.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00800
ref|ZP_05642998.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05680858.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05684090.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05690004.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05692482.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695177.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05696598.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05699630.1 Staphylococcus aureus A5948 RefSeq   conserved hypothetical protein
ref|ZP_05703673.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IP36 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein precursor
tr|A6QDF2 Staphylococcus aureus (strain Newman) TrEMBL   Putative uncharacterized protein
tr|A6TXV1 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein precursor
tr|A7WXE6 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|A8YZ89 Staphylococcus aureus (strain USA300 / TCH1516) TrEMBL   Hypothetical membrane protein
tr|Q2FK95 Staphylococcus aureus (strain USA300) TrEMBL   Putative uncharacterized protein
tr|Q2G1J1 Staphylococcus aureus (strain NCTC 8325) TrEMBL   Putative uncharacterized protein
tr|Q5HJK4 Staphylococcus aureus (strain COL) TrEMBL   Putative uncharacterized protein
tr|Q7A826 Staphylococcus aureus (strain N315) TrEMBL   Putative uncharacterized protein SA0161
tr|Q99X55 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link

  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key		 Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer

Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options
Tool Description
General Tools
Psi-Blast NCBI's psi-blast is used to locate distant similarities
Transmembrane Predictions
TMpred Tool for Predicting Transmembrane regions
TMHMM Prediction of transmembrane helices in proteins
Protein Signals for Gram negative bacteria
Gram negative PSORT Prediction of protein localization sites
Gram negative SignalP Predicts the presence and location of signal peptide cleavage sites
Protein Signals for Gram positive bacteria
Gram positive PSORT Prediction of protein localization sites
Gram positive SignalP Predicts the presence and location of signal peptide cleavage sites
Other useful tools
LipoP Prediction of lipoproteins and signal peptides in Gram negative bacteria
Radar Rapid Automatic Detection and Alignment of Repeats in protein sequences
PPSearch Search for protein motifs against all patterns stored in the PROSITE pattern database
Gram negative CELLO Subcellular localization predictor at National Chiao Tung University
Gram positive CELLO Subcellular localization predictor at National Chiao Tung University
ProDom A comprehensive set of protein domain families automatically generated from the SWISS-PROT and TrEMBL sequence databases
PDB An Information Portal to Biological Macromolecular Structures
For Specific Organisms
RNAFold The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences.

< Hide tool descriptions
FIG search