The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1552: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: tRNA 5-hydroxyuridine(34) synthetase TrhP2
Translate Function Assignments



Context on contig NC_002745 from base 1637294 to 1651964 (14671 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1545 1638655 1637294 1362 -       1: 1   Biotin carboxylase (EC 6.3.4.14) locus|SA1434, protein_id|NP_374719.1, gi|15927186, geneID|1124276
1546 1639118 1638669 450 - 13     2: 16 1   Biotin carboxyl carrier protein associated with SAR1687-8 locus|SA1435, protein_id|NP_374720.1, gi|15927187, geneID|1124277
1547 1640130 1639120 1011 - 1     5: 4 3 6 7 1   5-oxoprolinase subunit C (EC 3.5.2.9) locus|SA1436, protein_id|NP_374721.1, gi|15927188, geneID|1124278
1548 1640854 1640120 735 - -11     5: 4 3 6 7 1   5-oxoprolinase subunit B (EC 3.5.2.9) locus|SA1437, protein_id|NP_374722.1, gi|15927189, geneID|1124279
1549 1641656 1641180 477 - 325 4 1: 12   Transcription elongation factor GreA gene_name|greA, locus|SA1438, protein_id|NP_374723.1, gi|15927190, geneID|1124280
1550 1642307 1641684 624 - 27 5 1: 10   Uridine kinase (EC 2.7.1.48) gene_name|udk, locus|SA1439, protein_id|NP_374724.1, gi|15927191, geneID|1124281
1551 1643575 1642307 1269 - -1 7     tRNA 5-hydroxyuridine(34) synthetase TrhP locus|SA1440, protein_id|NP_374725.1, gi|15927192, geneID|1124282
1552 1644510 1643587 924 - 11       tRNA 5-hydroxyuridine(34) synthetase TrhP2 locus|SA1441, protein_id|NP_374726.1, gi|15927193, geneID|1124283
1553 1645151 1644513 639 - 2 8     tRNA 5-hydroxyuridine(34) methyltransferase TrmR locus|SA1442, protein_id|NP_374727.1, gi|15927194, geneID|1124284
1554 1645744 1645436 309 - 284         FIG01108372: hypothetical protein locus|SA1443, protein_id|NP_374728.1, gi|15927195, geneID|1124285
1555 1646187 1645759 429 - 14     5: 9 8 15 5 2   Putative pre-16S rRNA nuclease YqgF locus|SA1444, protein_id|NP_374729.1, gi|15927196, geneID|1124286
1556 1646451 1646191 261 - 3 4 1: 2   UPF0297 protein YrzL locus|SA1445, protein_id|NP_374730.1, gi|15927197, geneID|1124287
1557 1649144 1646514 2631 - 62     4: 13 11 5 2   Alanyl-tRNA synthetase (EC 6.1.1.7) gene_name|alaS, locus|SA1446, protein_id|NP_374731.1, gi|15927198, geneID|1124288
1558 1651964 1649487 2478 - 342     1: 14   RecD-like DNA helicase YrrC locus|SA1447, protein_id|NP_374732.1, gi|15927199, geneID|1124289

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.1552 tRNA 5-hydroxyuridine(34) synthetase TrhP2
MTELLVTPKSLSHMETLIDLGADAFVIGEQKFGLRLPGEFNRQQMTEAVALAHKNDKKVY
AAVNGLFHNYHLDAVEDYINFLHEIRVDRIIFGDPAVVMYVKAQENPIPLHWNAETLVTN
HFQCNYWGKRGASRAVLARELNLDEIINIKENSNVEIEVQVQGMTCMFQSKRMLLGNYYT
FQDRQMKIERRNDEQSLLLYDEERQNNYPVYEDYNGTHIMSPNDICLIEELAPFFEAGID
SFKIDGILQTEEYINVVTEQYRQAIDLYNEDPEIYEDEKFMLIDPIEEIQPDHRPFDEGF
LYKQTVY

MD5 = cc50f5afc17dce5825e37b9d67a5c4b4


  DNA Sequence

>fig|158879.11.peg.1552 tRNA 5-hydroxyuridine(34) synthetase TrhP2
atgacagaattacttgtcacacccaagtcattaagccatatggaaacacttattgattta
ggtgcagatgcttttgtaattggcgagcaaaagtttggtttaagacttccaggggaattc
aatagacaacaaatgacagaggctgtcgcattagctcacaaaaacgataaaaaagtatat
gcggcagtgaatggattatttcataattatcatttagatgctgtagaagattatattaat
tttttacatgaaatacgagttgacagaattattttcggggatccagcagtagtaatgtat
gtgaaggcgcaagaaaatccaataccacttcattggaatgcagagacgttagtaactaat
cattttcaatgtaattactggggtaaaagaggcgcatcaagagctgtcttagcacgtgag
ctgaatttggatgaaattattaatataaaagaaaattcaaatgtggaaattgaggtgcaa
gttcaaggaatgacttgtatgttccaatcaaagcgtatgctactaggcaattattatacg
ttccaagatcgccaaatgaaaattgaacgtcgcaatgatgaacaatctttattactttat
gatgaagaaagacaaaataattacccagtttacgaagattacaatggtacgcacattatg
tcaccaaacgacatttgtttaattgaagaattagcaccattttttgaggcgggtatagat
tcatttaaaatcgatggtattctacaaacggaagaatatattaatgtggtaacggaacag
tatcgtcaagcgatagatttgtacaatgaagatcctgaaatctatgaagatgagaaattt
atgttgattgatccaattgaagaaattcaacctgatcatcgaccatttgacgaaggtttc
ttatataaacaaacagtatattaa


  DNA with Flanking Sequence

>fig|158879.11.peg.1552 tRNA 5-hydroxyuridine(34) synthetase TrhP2
cgtatgaataatgttaaaaatattttagaaattggtacagcaatcggctatagttctatg
caattcgcttctatatctgatgacattcatgtcacaacgatagagcgtaatgaaacgatg
attcaatatgctaaacaaaatttagctacttatcattttgaaaaccaggttcgaattatt
gaaggtaatgctttagagcaatttgaaaatgtaaatgacaaagtttatgatatgatattt
attgatgcagcaaaagcgcaatcaaagaaattttttgaaatatatacaccacttttaaag
caccaaggtctcgtaattacagataatgttttatatcacggttttgtatcggatattggg
attgttagatcgagaaatgtaagacaaatggttaaaaaggttcaagattataatgagtgg
ttaataaagcaaccaggatatacaacgaattttttaaatatagacgatggattagcgatt
tcaattaaaggagaatgactatgacagaattacttgtcacacccaagtcattaagccata
tggaaacacttattgatttaggtgcagatgcttttgtaattggcgagcaaaagtttggtt
taagacttccaggggaattcaatagacaacaaatgacagaggctgtcgcattagctcaca
aaaacgataaaaaagtatatgcggcagtgaatggattatttcataattatcatttagatg
ctgtagaagattatattaattttttacatgaaatacgagttgacagaattattttcgggg
atccagcagtagtaatgtatgtgaaggcgcaagaaaatccaataccacttcattggaatg
cagagacgttagtaactaatcattttcaatgtaattactggggtaaaagaggcgcatcaa
gagctgtcttagcacgtgagctgaatttggatgaaattattaatataaaagaaaattcaa
atgtggaaattgaggtgcaagttcaaggaatgacttgtatgttccaatcaaagcgtatgc
tactaggcaattattatacgttccaagatcgccaaatgaaaattgaacgtcgcaatgatg
aacaatctttattactttatgatgaagaaagacaaaataattacccagtttacgaagatt
acaatggtacgcacattatgtcaccaaacgacatttgtttaattgaagaattagcaccat
tttttgaggcgggtatagattcatttaaaatcgatggtattctacaaacggaagaatata
ttaatgtggtaacggaacagtatcgtcaagcgatagatttgtacaatgaagatcctgaaa
tctatgaagatgagaaatttatgttgattgatccaattgaagaaattcaacctgatcatc
gaccatttgacgaaggtttcttatataaacaaacagtatattaaggaggttaatcatgaa
gacaatagaagagattaaatcaactcctaaaacagttatgaagaaaccagaattattagc
acctgctggaaacttagaaaagttaaaaatagcagtacattatggcgctgatgccgtatt
tttaggtggtcaagaatatggattacgttcaaatgctgataatttcacgatggaagaaat
agctgaaggtgttgaatttgcgaaccgttacggtgccaaaatttatgttacgacaaatat
tattgcacatgatgagaatattgaaggtctagaatcatatttgcgtaatttggaaaagac
tggtgcgacaggtatcattgttgcagatcctttaattatcgaaacatgtaaagaagttgc
gccaaaacttgaaattcatttatctactcaacaatcactttctaattacaaagctgtaga
atattggaaagaagaaggattggatcgtgttgtattagcacgtgagaccggcgcgatgga
aatg


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0006508       P:proteolysis
GO:0008233       F:peptidase activity
cmr|NT01SA1573 Staphylococcus aureus N315     peptidase, U32 family
cmr|NT02SA1595 Staphylococcus aureus Mu50     protease
dbj|BAB42705.1 Staphylococcus aureus subsp. aureus N315     SA1441
dbj|BAB57775.1 Staphylococcus aureus subsp. aureus Mu50     protease
dbj|BAF78483.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.1613 Staphylococcus aureus subsp. aureus Mu50 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|158878.14.peg.1663 Staphylococcus aureus subsp. aureus Mu50 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|158879.1.peg.1488 Staphylococcus aureus subsp. aureus N315 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|359786.13.peg.1767 Staphylococcus aureus subsp. aureus JH9 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|359786.3.peg.262 Staphylococcus aureus subsp. aureus JH9 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|359787.11.peg.1744 Staphylococcus aureus subsp. aureus JH1 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|359787.3.peg.1470 Staphylococcus aureus subsp. aureus JH1 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|418127.6.peg.1641 Staphylococcus aureus subsp. aureus Mu3 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|505321.3.peg.706 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553565.3.peg.313 Staphylococcus aureus A5937 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553568.3.peg.1091 Staphylococcus aureus A6224 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553571.3.peg.1896 Staphylococcus aureus A6300 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553573.3.peg.1447 Staphylococcus aureus A8115 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553574.3.peg.459 Staphylococcus aureus A8117 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553577.3.peg.1749 Staphylococcus aureus A8796 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553580.3.peg.1877 Staphylococcus aureus A8819 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553581.3.peg.1529 Staphylococcus aureus A9299 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553588.3.peg.513 Staphylococcus aureus A9719 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553592.3.peg.1320 Staphylococcus aureus A9763 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553596.3.peg.549 Staphylococcus aureus A9781 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|553601.3.peg.1747 Staphylococcus aureus A10102 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|585891.3.peg.1660 Staphylococcus aureus subsp. aureus Mu50-omega FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|680649.3.peg.2088 Staphylococcus aureus subsp. aureus MR1 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
fig|681288.4.peg.1608 Staphylococcus aureus subsp. aureus ED98 FIG   tRNA 5-hydroxyuridine(34) synthetase TrhP2
gb|ABQ49461.1 Staphylococcus aureus subsp. aureus JH9     peptidase U32
gb|ABR52550.1 Staphylococcus aureus subsp. aureus JH1     peptidase U32
gb|EEV87071.1 Staphylococcus aureus A5937     peptidase U32
gi|13701411 Staphylococcus aureus subsp. aureus N315 NCBI   SA1441
gi|14247384 Staphylococcus aureus subsp. aureus Mu50 NCBI   protease
gi|147741163 Staphylococcus aureus subsp. aureus JH9 NCBI   peptidase U32
gi|148268094 Staphylococcus aureus subsp. aureus JH9 NCBI   peptidase U32
gi|149946614 Staphylococcus aureus subsp. aureus JH1 NCBI   peptidase U32
gi|150394162 Staphylococcus aureus subsp. aureus JH1 NCBI   peptidase U32
gi|156722066 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979931 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1600
gi|15924603 Staphylococcus aureus subsp. aureus Mu50 NCBI   protease
gi|15927193 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1441
gi|253315243 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_03592
gi|255006398 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_08015
gi|257864321 Staphylococcus aureus A5937 NCBI   peptidase U32
gi|258453590 Staphylococcus aureus A5937 NCBI   peptidase U32
img|637093108 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100122 Staphylococcus aureus aureus Mu50 IMG   protease
img|639107723 Staphylococcus aureus aureus JH1 IMG   Peptidase U32
img|640566014 Staphylococcus aureus aureus JH9 IMG   peptidase U32
img|640779784 Staphylococcus aureus aureus JH1 IMG   peptidase U32
img|640904344 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_1704 Staphylococcus aureus subsp. aureus JH1 KEGG   peptidase U32
kegg|saj:SaurJH9_1670 Staphylococcus aureus subsp. aureus JH9 KEGG   peptidase U32
kegg|sau:SA1441   KEGG   hypothetical protein
kegg|sav:SAV1613   KEGG   protease
kegg|saw:SAHV_1600 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372137.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   protease
ref|NP_374726.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1441
ref|YP_001247037.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   peptidase U32
ref|YP_001316837.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   peptidase U32
ref|YP_001442190.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1600
ref|ZP_04838456.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_03592
ref|ZP_05144999.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_08015
ref|ZP_05701568.1 Staphylococcus aureus A5937 RefSeq   peptidase U32
tr|A5ITD8 Staphylococcus aureus (strain JH9) TrEMBL   Peptidase U32
tr|A6U282 Staphylococcus aureus (strain JH1) TrEMBL   Peptidase U32
tr|A7X322 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A5A0 Staphylococcus aureus (strain N315) TrEMBL   SA1441 protein
tr|Q99TN6 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Protease


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|158879.11.peg.1549 Transcription elongation factor GreA
5 fig|158879.11.peg.1550 Uridine kinase (EC 2.7.1.48)
7 fig|158879.11.peg.1551 tRNA 5-hydroxyuridine(34) synthetase TrhP
8 fig|158879.11.peg.1553 tRNA 5-hydroxyuridine(34) methyltransferase TrmR
4 fig|158879.11.peg.1556 UPF0297 protein YrzL


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search