The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1490: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Zinc ABC transporter, permease protein ZnuB
Translate Function Assignments



Context on contig NC_002745 from base 1583341 to 1595250 (11910 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1484 1584804 1583341 1464 -           Rhomboid family serine protease Mvan_5753 locus|SA1379, protein_id|NP_374662.1, gi|15927129, geneID|1124219
1485 1585409 1584816 594 - 11     4: 15 16 25 5   5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) locus|SA1380, protein_id|NP_374663.1, gi|15927130, geneID|1124220
1486 1585713 1585564 150 - 154     3: 13 12 1   LSU ribosomal protein L33p @ LSU ribosomal protein L33p, zinc-independent gene_name|rpmG, locus|SAS047, protein_id|NP_374664.1, gi|15927131, geneID|1124221
1487 1587901 1585826 2076 - 112 4 6: 24 22 9 17 21 10   Uncharacterized protein YqgF gene_name|pbp3, locus|SA1381, protein_id|NP_374665.1, gi|15927132, geneID|1124222
1488 1588621 1588022 600 - 120 5 6: 18 20 8 4 11 6 dlit(10383955)
dlit(11948161)
dlit(14523108)
dlit(16514164)
Superoxide dismutase [Mn] (EC 1.15.1.1); Superoxide dismutase [Fe] (EC 1.15.1.1) gene_name|sodA, locus|SA1382, protein_id|NP_374666.1, gi|15927133, geneID|1124223
1489 1589307 1588897 411 - 275 17 2: 4 1 dlit(11320129) Zinc uptake regulation protein Zur locus|SA1383, protein_id|NP_374667.1, gi|15927134, geneID|1124224
1490 1590157 1589294 864 - -14   1: 1 dlit(11320129) Zinc ABC transporter, permease protein ZnuB locus|SA1384, protein_id|NP_374668.1, gi|15927135, geneID|1124225
1491 1590984 1590199 786 - 41 45 1: 1   Zinc ABC transporter, ATP-binding protein ZnuC locus|SA1385, protein_id|NP_374669.1, gi|15927136, geneID|1124226
1492 1592000 1591110 891 - 125     2: 23 14   Endonuclease IV (EC 3.1.21.2) locus|SA1386, protein_id|NP_374670.1, gi|15927137, geneID|1124227
1493 1593356 1592010 1347 - 9 5 1: 19   DEAD-box ATP-dependent RNA helicase CshB (EC 3.6.4.13) locus|SA1387, protein_id|NP_374671.1, gi|15927138, geneID|1124228
1494 1594570 1593470 1101 - 113     3: 7 2 3   Nif3-like dinuclear metal center hexameric protein @ Bsu YqfO NIF3/CutA domain locus|SA1388, protein_id|NP_374672.1, gi|15927139, geneID|1124229
1495 1595250 1594573 678 - 2     2: 2 3   tRNA (adenine(22)-N(1))-methyltransferase (EC 2.1.1.217) ## TrmK locus|SA1389, protein_id|NP_374673.1, gi|15927140, geneID|1124230

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
COG0523 cHaas Zinc ABC transporter, inner membrane permease protein ZnuB


  Protein Sequence

>fig|158879.11.peg.1490 Zinc ABC transporter, permease protein ZnuB
MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIHKW
IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK

MD5 = 4bc106730a1754fb1cf92eab9a51ebfc


  DNA Sequence

>fig|158879.11.peg.1490 Zinc ABC transporter, permease protein ZnuB
ttgatagatgcattattgaattttgattttatgaggtactctttaattagtggtatcttg
ataggttttattgcgcctctaatcggtgcttttatcgttgttagacgactatcacttata
gctgatgctctaagtcatgtaactttaggtggtatatccttcggtatgtttttacttact
attatgccaacactagtatttattaatccaatgtggtttggaatcttattcgcaatagta
ggtgcgcttctaattgaaaaattaagaacgtcatacactgcttaccaagaaattgctatt
ccaattataatgagtgctggtatcgccttgagtgcaatcttcatttcattagctgatggg
ttcaatcaagaaattgttggattgctatttggctcaataagcgcagtgaatataagtgat
ttaacaacgattattgtcattgccatcatagttgttctgtttattacattgttttataaa
gaattatttatattgtcatttgatgaggaatatagtaaagtcattggcattcataaatgg
attcaatttttatttattgttattgtagcgatggttatttctgcctcaatgcgtgttgta
gggatactgttagtaagtgctttaatcacgttaccaattgcaataagtatgcgaataaca
aaaagttttaagcaattgatattactaagtgtatttttaggtgaattatcagtaatatta
ggcttagtcctagctttctatatggacatttctccgggtggtgtaattgtagttctacta
gttattttacttatgattacaatggcttatcagaaaatgcgaatgaagtttaaaaaggga
gctaatatcaatgaatacaaatga


  DNA with Flanking Sequence

>fig|158879.11.peg.1490 Zinc ABC transporter, permease protein ZnuB
acaaagacaaaacgtcttttccaaacatttaatagcaaagataatgaaaaagtgattaaa
gtactagaaagactgaatataagtgatttaattcataaaaatatagcagaattatcaggt
ggtcaacaacaacgtgtaatgattgcccgagcattgatttcagaacctgcagtattagta
cttgatgaaccaacgaatggtattgatgcaaaacatgtaagtgaattttataatacttta
gatcaattaaaacaagaaggtatcaccattatcttagttactcatgatatcggtgttgta
gcagatactgctactgaagtagcatgtttaaataagcatttgcatttccatggtacaact
gatgagtttaaatcacttgatgaagttgaaatttcaaaaatttatggacatcctgtacgt
tttgtcgatcatcagcataatcgagaatgttgtaattaataaagatttgagtttatttaa
aatggaaaggcgtgtcacaattgatagatgcattattgaattttgattttatgaggtact
ctttaattagtggtatcttgataggttttattgcgcctctaatcggtgcttttatcgttg
ttagacgactatcacttatagctgatgctctaagtcatgtaactttaggtggtatatcct
tcggtatgtttttacttactattatgccaacactagtatttattaatccaatgtggtttg
gaatcttattcgcaatagtaggtgcgcttctaattgaaaaattaagaacgtcatacactg
cttaccaagaaattgctattccaattataatgagtgctggtatcgccttgagtgcaatct
tcatttcattagctgatgggttcaatcaagaaattgttggattgctatttggctcaataa
gcgcagtgaatataagtgatttaacaacgattattgtcattgccatcatagttgttctgt
ttattacattgttttataaagaattatttatattgtcatttgatgaggaatatagtaaag
tcattggcattcataaatggattcaatttttatttattgttattgtagcgatggttattt
ctgcctcaatgcgtgttgtagggatactgttagtaagtgctttaatcacgttaccaattg
caataagtatgcgaataacaaaaagttttaagcaattgatattactaagtgtatttttag
gtgaattatcagtaatattaggcttagtcctagctttctatatggacatttctccgggtg
gtgtaattgtagttctactagttattttacttatgattacaatggcttatcagaaaatgc
gaatgaagtttaaaaagggagctaatatcaatgaatacaaatgatgctattaaaatttta
aaagagaacggtttaaaatatacagataaacgtaaagatatgttagatatttttgtcgaa
gaagataagtatataaacgcaaagtatatacaacaagttatggatgaaaattatcctgga
atttcattcgacacaatatatagaaacctgcacttatttaaagatttagggattattgaa
aatacagaacttgatggtgaaatgaagtttagaatcgcttgtacaaaccatcatcatcat
cattttatctgtgaaaagtgtggagatacaaaggtaatagattattgtccaatagatcag
ataaagttatcactacctggtgttaatattcacaaacacaaacttgaagtttatggtgta
tgtgagtcttgccaagattaatataaagaaatgagatttatgcacatttggtcagatgta
tgcataaatctcattttttaaattatagaagataaaggttcatttcatactccgttcgta
tgat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0005524       F:ATP binding
GO:0006810       P:transport
GO:0016021       C:integral to membrane
GO:0042626       F:ATPase activity, coupled to transmembrane m...
cmr|NT02SA1540 Staphylococcus aureus Mu50     ABC transporter MreB
dbj|BAB42647.1 Staphylococcus aureus subsp. aureus N315     SA1384
dbj|BAB57717.1 Staphylococcus aureus subsp. aureus Mu50     ABC transporter MreB
dbj|BAF78425.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.1555 Staphylococcus aureus subsp. aureus Mu50 FIG   Zinc ABC transporter, permease protein ZnuB
fig|158879.1.peg.1430 Staphylococcus aureus subsp. aureus N315 FIG   Zinc ABC transporter, permease protein ZnuB
fig|359786.13.peg.1704 Staphylococcus aureus subsp. aureus JH9 FIG   Zinc ABC transporter, permease protein ZnuB
fig|359787.11.peg.1681 Staphylococcus aureus subsp. aureus JH1 FIG   Zinc ABC transporter, permease protein ZnuB
fig|418127.6.peg.1579 Staphylococcus aureus subsp. aureus Mu3 FIG   Zinc ABC transporter, permease protein ZnuB
fig|505321.3.peg.379 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Zinc ABC transporter, permease protein ZnuB
fig|553565.3.peg.253 Staphylococcus aureus A5937 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553568.3.peg.1031 Staphylococcus aureus A6224 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553571.3.peg.1836 Staphylococcus aureus A6300 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553573.3.peg.1385 Staphylococcus aureus A8115 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553574.3.peg.399 Staphylococcus aureus A8117 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553577.3.peg.1810 Staphylococcus aureus A8796 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553580.3.peg.1816 Staphylococcus aureus A8819 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553581.3.peg.1423 Staphylococcus aureus A9299 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553588.3.peg.450 Staphylococcus aureus A9719 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553592.3.peg.1380 Staphylococcus aureus A9763 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553596.3.peg.486 Staphylococcus aureus A9781 FIG   Zinc ABC transporter, permease protein ZnuB
fig|553601.3.peg.1687 Staphylococcus aureus A10102 FIG   Zinc ABC transporter, permease protein ZnuB
fig|585891.3.peg.1598 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Zinc ABC transporter, permease protein ZnuB
fig|680649.3.peg.419 Staphylococcus aureus subsp. aureus MR1 FIG   Zinc ABC transporter, permease protein ZnuB
fig|681288.4.peg.1545 Staphylococcus aureus subsp. aureus ED98 FIG   Zinc ABC transporter, permease protein ZnuB
fig|703339.3.peg.1540 Staphylococcus aureus 04-02981 FIG   Zinc ABC transporter, permease protein ZnuB
gi|13701353 Staphylococcus aureus subsp. aureus N315 NCBI   SA1384
gi|14247326 Staphylococcus aureus subsp. aureus Mu50 NCBI   ABC transporter MreB
gi|156722008 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979873 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1542
gi|15924545 Staphylococcus aureus subsp. aureus Mu50 NCBI   ABC transporter MreB
gi|15927135 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1384
gi|253314926 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   ABC-3 protein
gi|255006341 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   ABC-3 protein
img|637093050 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100064 Staphylococcus aureus aureus Mu50 IMG   ABC transporter MreB
img|640904286 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sau:SA1384   KEGG   hypothetical protein
kegg|sav:SAV1555   KEGG   ABC transporter MreB
kegg|saw:SAHV_1542 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372079.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   ABC transporter MreB
ref|NP_374668.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1384
ref|YP_001442132.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1542
ref|ZP_04838139.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   ABC-3 protein
ref|ZP_05144942.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   ABC-3 protein
tr|A7X2V0 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A5D4 Staphylococcus aureus (strain N315) TrEMBL   SA1384 protein
tr|Q99TU1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   ABC transporter MreB


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
4 fig|158879.11.peg.1487 Uncharacterized protein YqgF
5 fig|158879.11.peg.1488 Superoxide dismutase [Mn] (EC 1.15.1.1); Superoxide dismutase [Fe] (EC 1.15.1.1)
17 fig|158879.11.peg.1489 Zinc uptake regulation protein Zur
45 fig|158879.11.peg.1491 Zinc ABC transporter, ATP-binding protein ZnuC
5 fig|158879.11.peg.1493 DEAD-box ATP-dependent RNA helicase CshB (EC 3.6.4.13)


  Attributes

Help on Attributes

Key
Link Explains Key
Value
evidence_code dlit(11320129);gjo


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search