The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1478: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Late competence protein ComGB, access of DNA to ComEA
Translate Function Assignments



Context on contig NC_002745 from base 1572869 to 1585409 (12541 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1470 1574341 1572869 1473 -       5: 20 8 3 2 9   Glycine dehydrogenase (aminomethyl-transferring) (glycine cleavage system P2 protein) (EC 1.4.4.2) locus|SA1365, protein_id|NP_374648.1, gi|15927115, geneID|1124205
1471 1575680 1574334 1347 - -8     2: 3 2   Glycine dehydrogenase (aminomethyl-transferring) (glycine cleavage system P1 protein) (EC 1.4.4.2) locus|SA1366, protein_id|NP_374649.1, gi|15927116, geneID|1124206
1472 1576791 1575700 1092 - 19     3: 3 2 5   Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10) gene_name|gcvT, locus|SA1367, protein_id|NP_374650.1, gi|15927117, geneID|1124207
1473 1577474 1576950 525 - 158 10 5: 14 18 12 15 21   Shikimate kinase I (EC 2.7.1.71) # AroE I locus|SA1368, protein_id|NP_374651.1, gi|15927118, geneID|1124208
1474 1578081 1577707 375 - 232     1: 1   Late competence protein ComGF, access of DNA to ComEA, FIG017774 locus|SA1369, protein_id|NP_374652.1, gi|15927119, geneID|1124209
1475 1578421 1578122 300 - 40     1: 1   Late competence protein ComGE, FIG018915 locus|SA1370, protein_id|NP_374653.1, gi|15927120, geneID|1124210
1476 1578812 1578408 405 - -14     1: 1   Late competence protein ComGD, access of DNA to ComEA, FIG012777 locus|SA1371, protein_id|NP_374654.1, gi|15927121, geneID|1124211
1477 1579143 1578832 312 - 19 12 1: 1   Late competence protein ComGC, access of DNA to ComEA, FIG007487 locus|SA1372, protein_id|NP_374655.1, gi|15927122, geneID|1124212
1478 1580227 1579157 1071 - 13   2: 1 4   Late competence protein ComGB, access of DNA to ComEA locus|SA1373, protein_id|NP_374656.1, gi|15927123, geneID|1124213
1479 1581173 1580199 975 - -29 25 2: 1 4   Late competence protein ComGA, access of DNA to ComEA locus|SA1374, protein_id|NP_374657.1, gi|15927124, geneID|1124214
1480 1581848 1581225 624 - 51 4 4: 10 11 17 13   MBL-fold metallo-hydrolase superfamily locus|SA1375, protein_id|NP_374658.1, gi|15927125, geneID|1124215
1481 1582174 1581845 330 - -4         DUF77 protein YqgV locus|SA1376, protein_id|NP_374659.1, gi|15927126, geneID|1124216
1482 1583160 1582174 987 - -1     1: 7   Glucokinase (EC 2.7.1.2) gene_name|glcK, locus|SA1377, protein_id|NP_374660.1, gi|15927127, geneID|1124217
1483 1583360 1583157 204 - -4         Uncharacterized protein YqgQ locus|SA1378, protein_id|NP_374661.1, gi|15927128, geneID|1124218
1484 1584804 1583341 1464 - -20         Rhomboid family serine protease Mvan_5753 locus|SA1379, protein_id|NP_374662.1, gi|15927129, geneID|1124219
1485 1585409 1584816 594 - 11     4: 16 19 22 6   5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) locus|SA1380, protein_id|NP_374663.1, gi|15927130, geneID|1124220

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Gram_Positive_Competence RamyA Late competence protein ComGB, access of DNA to ComEA
Late_competence VeronikaV Late competence protein ComGB, access of DNA to ComEA


  Protein Sequence

>fig|158879.11.peg.1478 Late competence protein ComGB, access of DNA to ComEA
MKLQWINTFKLHSKKRQLSKAQQIDLLSNLCNLLKYGFTLYQSFQFLNLQMTYKNKQLGT
TILSEISNGAPCNQILSLIGYSDTIVMQVYLAERFGNIIDVLEETVNYMKVNRKSEQRLL
KTLQYPLILVSIFIAMIIILNLTVIPQFQQLYTSMNIQLSSFQKTLSFFITSLPTIIVVM
LIIVSMLAIIMKLIYNNLNMLNKINFVMKLPLISGYFQLFKTYFVTNELVLFYKNGITLQ
SIVDVYINHSSDPFRQFLGKYLLTYSEMGYGLPQILEKLKCFKPQLIKFVLQGEKRGKLE
VELKLYSQILVKQIEDKAIKQTQFLQPILFLILGLFIVAIYLVIMLPMFQMMQSIK

MD5 = e7a5f10db3dbdc30e060288570e4219d


  DNA Sequence

>fig|158879.11.peg.1478 Late competence protein ComGB, access of DNA to ComEA
gtgaaactacaatggataaatacatttaaactacattctaagaagcgacaattaagtaag
gcccaacaaatcgatttactttcaaatttatgtaatttgttgaaatatggtttcactctg
tatcaaagttttcaatttttaaatcttcaaatgacatataaaaataagcaattaggtacc
accattctaagtgaaatttcaaatggtgcaccatgcaatcaaatattatcactgataggt
tatagcgatactatcgtcatgcaagtatatttggcagaaagatttggcaatattatagac
gttctagaagaaaccgtaaattatatgaaagtgaatagaaagtcagaacaacgattgtta
aagacactgcaataccccttaatactagtttctatctttattgctatgattattatatta
aacctcacagtaattccacagtttcaacaattatatacttctatgaatattcaactatct
tcttttcaaaaaacattgtcttttttcattaccagcttacctactataattgtagtaatg
ctcataatagtatctatgttggctattattatgaaattaatttataacaatttaaatatg
ctcaataagataaactttgtgatgaaactaccgctaatatcaggctatttccaattattt
aaaacttattttgtaactaatgaattagtgttgttttataaaaatggtattacacttcaa
tcaatagtagacgtttatattaaccatagtagtgatccatttagacagtttctaggtaaa
tacttattaacttattcagaaatgggatatggtttgcctcaaattttagaaaaactaaaa
tgctttaagcctcaattaattaagtttgtgctacaaggtgaaaagagagggaagctagaa
gtagaactaaagttatattcgcaaatattagtaaaacaaatagaagataaagcgataaaa
cagactcagtttttacagcctattttatttttgattttaggtttatttattgtcgcaatt
tatttagtaattatgttaccaatgtttcaaatgatgcaaagtataaaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.1478 Late competence protein ComGB, access of DNA to ComEA
ggtctcatacgcgaataaagccttgaatttaaatgtaatttctatagaggatcctgtaga
gatgcaaattcctggtatcgtccaaattaatgtgaatgataaagctggcattaactatgt
aaattcgtttaaagctattttaagatgtgatcctgatgttattttaataggtgaaatcag
agataaagatgttgccaagtgtgttatacaggctagtttaagtggtcaccttgttctgac
tacattgcatgcaactgattgtaaaggtgctattttaaggctattagaaatgggcatttc
tgtacaagaattgatacaggcaactaacttaattataaaccaacgacttgtaactactat
taagcaacagcgacaattagtatgcgaaattctatctcagcaacaactccgatatttctt
ttcccataatcattcattaccatcatcatttaagaacttagaagataaacttgatgatat
gacaaaagcaggtgtcatttgtgaaactacaatggataaatacatttaaactacattcta
agaagcgacaattaagtaaggcccaacaaatcgatttactttcaaatttatgtaatttgt
tgaaatatggtttcactctgtatcaaagttttcaatttttaaatcttcaaatgacatata
aaaataagcaattaggtaccaccattctaagtgaaatttcaaatggtgcaccatgcaatc
aaatattatcactgataggttatagcgatactatcgtcatgcaagtatatttggcagaaa
gatttggcaatattatagacgttctagaagaaaccgtaaattatatgaaagtgaatagaa
agtcagaacaacgattgttaaagacactgcaataccccttaatactagtttctatcttta
ttgctatgattattatattaaacctcacagtaattccacagtttcaacaattatatactt
ctatgaatattcaactatcttcttttcaaaaaacattgtcttttttcattaccagcttac
ctactataattgtagtaatgctcataatagtatctatgttggctattattatgaaattaa
tttataacaatttaaatatgctcaataagataaactttgtgatgaaactaccgctaatat
caggctatttccaattatttaaaacttattttgtaactaatgaattagtgttgttttata
aaaatggtattacacttcaatcaatagtagacgtttatattaaccatagtagtgatccat
ttagacagtttctaggtaaatacttattaacttattcagaaatgggatatggtttgcctc
aaattttagaaaaactaaaatgctttaagcctcaattaattaagtttgtgctacaaggtg
aaaagagagggaagctagaagtagaactaaagttatattcgcaaatattagtaaaacaaa
tagaagataaagcgataaaacagactcagtttttacagcctattttatttttgattttag
gtttatttattgtcgcaatttatttagtaattatgttaccaatgtttcaaatgatgcaaa
gtataaaataatggaggttaatatatgtttaaatttcttaagaaaactcaagcgtttaca
ttgatagagatgctattagtgttattaatcatcagtttattattaattttaatcattcca
aatattgctaaacaaactgctcacatacaatcaacaggttgtaatgcacaggtaaaaatg
gttaatagtcaaattgaagcgtatgcattgaaacataatagaaatccatcgtctattgaa
gacttaattgcagatggttttataaaagaagcacaaaagacatgtaaatcaggagagaca
ataacaattagtaatggagaagcagttgcaaattagaaagcagtcagcatttactatgat
tgagatgcttgtggtaatgatgttaatcagtatatttctacttttgacaatgacatctaa
aggattaagcaatcttagagtaatagatgatgaggcaaatatcatttcttttattactga
attgaattatattaagtcgcaagctatagca


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA1503 Staphylococcus aureus N315     Bacterial type II secretion system protein F domain, putative
cmr|NT02SA1529 Staphylococcus aureus Mu50     DNA transport machinery protein comGB
cmr|NT03SA1627 Staphylococcus aureus MW2     Bacterial type II secretion system protein F domain, putative
cmr|NT09SA1469 Staphylococcus aureus subsp. aureus MSSA476     competence protein ComGB, putative
dbj|BAB42635.1 Staphylococcus aureus subsp. aureus N315     SA1373
dbj|BAB57705.1 Staphylococcus aureus subsp. aureus Mu50     similar to DNA transport mechinery protein comGB
dbj|BAB95360.1 Staphylococcus aureus subsp. aureus MW2     MW1495
dbj|BAF78413.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG43281.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   putative membrane protein
fig|158878.1.peg.1543 Staphylococcus aureus subsp. aureus Mu50 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|158878.14.peg.1589 Staphylococcus aureus subsp. aureus Mu50 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|158879.1.peg.1418 Staphylococcus aureus subsp. aureus N315 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|196620.1.peg.1495 Staphylococcus aureus subsp. aureus MW2 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|196620.5.peg.1561 Staphylococcus aureus subsp. aureus MW2 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|282459.1.peg.1467 Staphylococcus aureus subsp. aureus MSSA476 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|282459.5.peg.1541 Staphylococcus aureus subsp. aureus MSSA476 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|359786.13.peg.1692 Staphylococcus aureus subsp. aureus JH9 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|359786.3.peg.186 Staphylococcus aureus subsp. aureus JH9 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|359787.11.peg.1669 Staphylococcus aureus subsp. aureus JH1 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|359787.3.peg.1328 Staphylococcus aureus subsp. aureus JH1 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|418127.4.peg.1422 Staphylococcus aureus subsp. aureus Mu3 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|418127.6.peg.1567 Staphylococcus aureus subsp. aureus Mu3 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|450394.6.peg.798 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|548475.3.peg.532 Staphylococcus aureus subsp. aureus TCH70 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553568.3.peg.1019 Staphylococcus aureus A6224 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553571.3.peg.1824 Staphylococcus aureus A6300 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553573.3.peg.1373 Staphylococcus aureus A8115 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553574.3.peg.387 Staphylococcus aureus A8117 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553577.3.peg.1822 Staphylococcus aureus A8796 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553580.3.peg.1804 Staphylococcus aureus A8819 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553581.3.peg.1411 Staphylococcus aureus A9299 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553588.3.peg.438 Staphylococcus aureus A9719 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553592.3.peg.1392 Staphylococcus aureus A9763 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553596.3.peg.474 Staphylococcus aureus A9781 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|553601.3.peg.1675 Staphylococcus aureus A10102 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|585891.3.peg.1586 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Late competence protein ComGB, access of DNA to ComEA
fig|680649.3.peg.431 Staphylococcus aureus subsp. aureus MR1 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|681288.4.peg.1533 Staphylococcus aureus subsp. aureus ED98 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|703339.3.peg.1528 Staphylococcus aureus 04-02981 FIG   Late competence protein ComGB, access of DNA to ComEA
fig|762962.3.peg.443 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Late competence protein ComGB, access of DNA to ComEA
gb|ABQ49394.1 Staphylococcus aureus subsp. aureus JH9     type II secretion system protein
gb|ABR52483.1 Staphylococcus aureus subsp. aureus JH1     type II secretion system protein
gb|EES54644.1 Staphylococcus aureus subsp. aureus TCH70     competence protein ComGB
gb|EES92714.1 Staphylococcus aureus subsp. aureus USA300_TCH959     competence protein ComGB
gb|EEV25931.1 Staphylococcus aureus A9781     type II secretion system protein
gb|EEV64695.1 Staphylococcus aureus A9763     type II secretion system protein
gb|EEV68220.1 Staphylococcus aureus A9719     type II secretion system protein
gb|EEV72568.1 Staphylococcus aureus A9299     type II secretion system protein
gb|EEV74930.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV77312.1 Staphylococcus aureus A6300     DNA transport mechinery protein comGB
gb|EEV80869.1 Staphylococcus aureus A6224     DNA transport mechinery protein comGB
gi|13701341 Staphylococcus aureus subsp. aureus N315 NCBI   SA1373
gi|14247314 Staphylococcus aureus subsp. aureus Mu50 NCBI   similar to DNA transport mechinery protein comGB
gi|147741096 Staphylococcus aureus subsp. aureus JH9 NCBI   type II secretion system protein
gi|148268027 Staphylococcus aureus subsp. aureus JH9 NCBI   type II secretion system protein
gi|149946547 Staphylococcus aureus subsp. aureus JH1 NCBI   type II secretion system protein
gi|150394095 Staphylococcus aureus subsp. aureus JH1 NCBI   type II secretion system protein
gi|156721996 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979861 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1530
gi|15924533 Staphylococcus aureus subsp. aureus Mu50 NCBI   DNA transport mechinery protein comGB
gi|15927123 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1373
gi|21204664 Staphylococcus aureus subsp. aureus MW2 NCBI   MW1495
gi|21283224 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1495
gi|251801987 Staphylococcus aureus subsp. aureus TCH70 NCBI   competence protein ComGB
gi|251814539 Staphylococcus aureus subsp. aureus TCH70 NCBI   competence protein ComGB
gi|253723985 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   competence protein ComGB
gi|253732196 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   competence protein ComGB
gi|255006329 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_07670
gi|257787591 Staphylococcus aureus A9781 NCBI   type II secretion system protein
gi|257793619 Staphylococcus aureus A9781 NCBI   type II secretion system protein
gi|257840231 Staphylococcus aureus A9763 NCBI   type II secretion system protein
gi|257843826 Staphylococcus aureus A9719 NCBI   type II secretion system protein
gi|257848580 Staphylococcus aureus A9299 NCBI   type II secretion system protein
gi|257850987 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257854363 Staphylococcus aureus A6300 NCBI   DNA transport mechinery protein comGB
gi|257857980 Staphylococcus aureus A6224 NCBI   DNA transport mechinery protein comGB
gi|258411081 Staphylococcus aureus A9763 NCBI   type II secretion system protein
gi|258420115 Staphylococcus aureus A9719 NCBI   type II secretion system protein
gi|258437375 Staphylococcus aureus A9299 NCBI   type II secretion system protein
gi|258443581 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258446788 Staphylococcus aureus A6300 NCBI   DNA transport mechinery protein comGB
gi|258448702 Staphylococcus aureus A6224 NCBI   DNA transport mechinery protein comGB
gi|49244822 Staphylococcus aureus subsp. aureus MSSA476 NCBI   putative membrane protein
gi|49486379 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1481
img|637093038 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637100052 Staphylococcus aureus aureus Mu50 IMG   similar to DNA transport mechinery protein comGB
img|637157704 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299259 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|639107791 Staphylococcus aureus aureus JH1 IMG   type II secretion system protein
img|640565947 Staphylococcus aureus aureus JH9 IMG   type II secretion system protein
img|640779717 Staphylococcus aureus aureus JH1 IMG   type II secretion system protein
img|640904274 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_1635 Staphylococcus aureus subsp. aureus JH1 KEGG   type II secretion system protein
kegg|saj:SaurJH9_1601 Staphylococcus aureus subsp. aureus JH9 KEGG   type II secretion system protein
kegg|sam:MW1495 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sas:SAS1481   KEGG   hypothetical protein
kegg|sau:SA1373   KEGG   hypothetical protein
kegg|sav:SAV1543   KEGG   DNA transport mechinery protein comGB
kegg|saw:SAHV_1530 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_372067.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   DNA transport mechinery protein comGB
ref|NP_374656.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1373
ref|NP_646312.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1495
ref|YP_001246970.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   type II secretion system protein
ref|YP_001316770.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   type II secretion system protein
ref|YP_001442120.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1530
ref|YP_043600.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1481
ref|ZP_04829012.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   competence protein ComGB
ref|ZP_04866361.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   competence protein ComGB
ref|ZP_05144930.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_07670
ref|ZP_05642598.1 Staphylococcus aureus A9781 RefSeq   type II secretion system protein
ref|ZP_05681361.1 Staphylococcus aureus A9763 RefSeq   type II secretion system protein
ref|ZP_05683070.1 Staphylococcus aureus A9719 RefSeq   type II secretion system protein
ref|ZP_05689359.1 Staphylococcus aureus A9299 RefSeq   type II secretion system protein
ref|ZP_05691920.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05694942.1 Staphylococcus aureus A6300 RefSeq   DNA transport mechinery protein comGB
ref|ZP_05696814.1 Staphylococcus aureus A6224 RefSeq   DNA transport mechinery protein comGB
tr|A5IT71 Staphylococcus aureus (strain JH9) TrEMBL   Type II secretion system protein
tr|A6U215 Staphylococcus aureus (strain JH1) TrEMBL   Type II secretion system protein
tr|A7X2T2 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C5N5W9 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Competence protein ComGB
tr|C5QJP6 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Competence protein ComGB
tr|Q6G923 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative membrane protein
tr|Q7A0T1 Staphylococcus aureus (strain MW2) TrEMBL   MW1495 protein
tr|Q7A5E2 Staphylococcus aureus (strain N315) TrEMBL   SA1373 protein
tr|Q99TV1 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Similar to DNA transport mechinery protein comGB


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
10 fig|158879.11.peg.1473 Shikimate kinase I (EC 2.7.1.71) # AroE I
12 fig|158879.11.peg.1477 Late competence protein ComGC, access of DNA to ComEA, FIG007487
25 fig|158879.11.peg.1479 Late competence protein ComGA, access of DNA to ComEA
4 fig|158879.11.peg.1480 MBL-fold metallo-hydrolase superfamily


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search