The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1403: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
Translate Function Assignments



Context on contig NC_002745 from base 1504426 to 1514875 (10450 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1397 1505490 1504426 1065 -       5: 22 24 30 3 1   3-dehydroquinate synthase (EC 4.2.3.4) # AroB gene_name|aroB, locus|SA1298, protein_id|NP_374579.1, gi|15927046, geneID|1124136
1398 1506682 1505516 1167 - 25     6: 19 13 17 3 28 1   Chorismate synthase (EC 4.2.3.5) ## AroG gene_name|aroC, locus|SA1299, protein_id|NP_374580.1, gi|15927047, geneID|1124137
1399 1507268 1507068 201 - 385         Doubtful CDS. No database matches locus|SA1300, protein_id|NP_374581.1, gi|15927048, geneID|1124138
1400 1507926 1507477 450 - 208     5: 9 23 29 21 8   Nucleoside diphosphate kinase (EC 2.7.4.6) gene_name|ndk, locus|SA1301, protein_id|NP_374583.1, gi|15927050, geneID|1124140
1401 1508977 1508018 960 - 91     3: 16 27 2   Heptaprenyl diphosphate synthase component II (EC 2.5.1.30) gene_name|gerCC, locus|SA1302, protein_id|NP_374584.1, gi|15927051, geneID|1124141
1402 1509704 1508979 726 - 1     4: 5 11 15 10   2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (EC 2.1.1.201) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163) gene_name|ubiE, locus|SA1303, protein_id|NP_374585.1, gi|15927052, geneID|1124142
1403 1510279 1509707 573 - 2     1: 2   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30) locus|SA1304, protein_id|NP_374586.1, gi|15927053, geneID|1124143
1404 1510982 1510710 273 - 430     1: 18   DNA-binding protein HBsu gene_name|hu, locus|SA1305, protein_id|NP_374587.1, gi|15927054, geneID|1124144
1405 1512151 1511153 999 - 170     3: 12 26 6   Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94) gene_name|gpsA, locus|SA1306, protein_id|NP_374588.1, gi|15927055, geneID|1124145
1406 1513478 1512168 1311 - 16     2: 25 4   GTP-binding protein EngA gene_name|engA, locus|SA1307, protein_id|NP_374589.1, gi|15927056, geneID|1124146
1407 1514875 1513700 1176 - 221     3: 7 14 20   SSU ribosomal protein S1p gene_name|rpsA, locus|SA1308, protein_id|NP_374590.1, gi|15927057, geneID|1124147

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Isoprenoid_Biosynthesis_PanGenomes Ravcheev_Dmitry_user Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)


  Protein Sequence

>fig|158879.11.peg.1403 Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
METTVSKLERQIEERLKGVSEYESININHRLGKLLDSYDIPDVAKVACLTIDTSMRHLDD
ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
QKSYLKSRGN

MD5 = 63ebb532f00a8e93aea51ca462c48e5f


  DNA Sequence

>fig|158879.11.peg.1403 Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
atggaaacaactgttagcaaattggaaagacaaatagaagaaagattaaagggtgtatca
gaatatgaatccattaatattaatcatcggttaggtaagttacttgattcatatgatatt
ccagatgttgccaaagtagcatgcctcacaattgacacatcaatgagacaccttgatgac
attacatataatcatttgtctaaacattccattttgattggagatttaattagtgcacat
ttttatacgctactagcagaaatcaatgatttatcatttcaaaatgaaattagtaaagca
attgttgaaattaatgaattgaaatcttcattacatcatcaagctttaaatgattatgaa
atttctcaagcaatagtaaaaattgaaacacttttcccatatattacgttatctcatttc
ggtatcaatattgatgagtcggaaatatataattatttatttgaagatatgtctgattac
tatccatcatacttcaagaaatataatcaaagtgaagtaaagcattacttacacgatatc
caaaaaagttatttaaaaagtagaggtaattaa


  DNA with Flanking Sequence

>fig|158879.11.peg.1403 Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
aattgatatcccagcaagtaaagttccagcattcaaagctggtaaagcattaaaagatgc
tgtaaaataattttacttaaaaagccctgaataagggctttttattttgcttttaatact
tacaacctgtacataatttgtaatgttcttctaagtttttaatctttggaacattcattg
tttaagcgttcaaaatattacatgacataatagttttgataaaaatagcaactacaaaat
atacatatgaataatgagattaattgttagcgttgaatttacttaaaaggtaaccatgtc
tactatagtattttacgttatttaaaaagatgaataatgtaaatgaagtaaaggttatta
tgagaattacaaaagctacataaattactgttagtttaaattgaaatttaaaaatgataa
gtaatcttaatgcttcaaaagattttaatttcttacatataatgttaatatgaatagtga
taatatcgtgaggtgtagacatggaaacaactgttagcaaattggaaagacaaatagaag
aaagattaaagggtgtatcagaatatgaatccattaatattaatcatcggttaggtaagt
tacttgattcatatgatattccagatgttgccaaagtagcatgcctcacaattgacacat
caatgagacaccttgatgacattacatataatcatttgtctaaacattccattttgattg
gagatttaattagtgcacatttttatacgctactagcagaaatcaatgatttatcatttc
aaaatgaaattagtaaagcaattgttgaaattaatgaattgaaatcttcattacatcatc
aagctttaaatgattatgaaatttctcaagcaatagtaaaaattgaaacacttttcccat
atattacgttatctcatttcggtatcaatattgatgagtcggaaatatataattatttat
ttgaagatatgtctgattactatccatcatacttcaagaaatataatcaaagtgaagtaa
agcattacttacacgatatccaaaaaagttatttaaaaagtagaggtaattaagcatggc
tgacaataaagcaaataaagagcaagtacatcgcgtttttcaaaatatttcaaaaaaata
tgatagattaaataatattattagttttgagcagcataaagtatggagaaaacgcgtcat
gaaagacatgggtgttagaaaagggacgaaagcattagatgtttgttgtggtactggtga
ttggacaatcgcattaagcaaagctgtaggaccaacaggtgaagttactggtattgactt
tagtgagaatatgttagaagtaggaaaagaaaaaactgcttcaatggaaaatgttaaact
tgttcatggtgatgcaatggaattgccgtttgaagacaattcttttgattatgtaacaat
tgggtttggattaagaaatgtgccagactatttagtcgcgttaaaagaaatgaatagagt
acttaaaccaggtggtatggtggtatgtcttgaaacgagccaaccaactttgccagtctt
taaacaaatgtat


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
cmr|NT01SA1425 Staphylococcus aureus N315     conserved hypothetical protein
cmr|NT02SA1459 Staphylococcus aureus Mu50     hyothetical protein
cmr|NT03SA1486 Staphylococcus aureus MW2     hyothetical protein
cmr|NT08SA1445 Staphylococcus aureus subsp. aureus MRSA252     conserved hypothetical protein
cmr|NT09SA1400 Staphylococcus aureus subsp. aureus MSSA476     conserved hypothetical protein
dbj|BAB42565.1 Staphylococcus aureus subsp. aureus N315     SA1304
dbj|BAB57634.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAB95226.1 Staphylococcus aureus subsp. aureus MW2     MW1361
dbj|BAF78343.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
emb|CAG40479.1 Staphylococcus aureus subsp. aureus MRSA252 EMBL   hypothetical protein
emb|CAG43190.1 Staphylococcus aureus subsp. aureus MSSA476 EMBL   hypothetical protein
fig|158878.1.peg.1472 Staphylococcus aureus subsp. aureus Mu50 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|158878.14.peg.1515 Staphylococcus aureus subsp. aureus Mu50 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|158879.1.peg.1348 Staphylococcus aureus subsp. aureus N315 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|196620.1.peg.1361 Staphylococcus aureus subsp. aureus MW2 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|196620.5.peg.1426 Staphylococcus aureus subsp. aureus MW2 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|282458.1.peg.1401 Staphylococcus aureus subsp. aureus MRSA252 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|282458.4.peg.1485 Staphylococcus aureus subsp. aureus MRSA252 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|282459.1.peg.1399 Staphylococcus aureus subsp. aureus MSSA476 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|282459.5.peg.1472 Staphylococcus aureus subsp. aureus MSSA476 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|359786.13.peg.1618 Staphylococcus aureus subsp. aureus JH9 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|359786.3.peg.214 Staphylococcus aureus subsp. aureus JH9 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|359787.11.peg.1598 Staphylococcus aureus subsp. aureus JH1 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|359787.3.peg.1430 Staphylococcus aureus subsp. aureus JH1 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|418127.4.peg.1356 Staphylococcus aureus subsp. aureus Mu3 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|418127.6.peg.1496 Staphylococcus aureus subsp. aureus Mu3 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|450394.6.peg.718 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|505321.3.peg.1493 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|548470.3.peg.353 Staphylococcus aureus subsp. aureus MN8 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|548475.3.peg.397 Staphylococcus aureus subsp. aureus TCH70 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553565.3.peg.1318 Staphylococcus aureus A5937 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553568.3.peg.2091 Staphylococcus aureus A6224 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553571.3.peg.2402 Staphylococcus aureus A6300 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553573.3.peg.2674 Staphylococcus aureus A8115 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553574.3.peg.318 Staphylococcus aureus A8117 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553577.3.peg.706 Staphylococcus aureus A8796 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553580.3.peg.2361 Staphylococcus aureus A8819 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553581.3.peg.43 Staphylococcus aureus A9299 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553588.3.peg.937 Staphylococcus aureus A9719 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553592.3.peg.1592 Staphylococcus aureus A9763 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553596.3.peg.2400 Staphylococcus aureus A9781 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|553601.3.peg.1527 Staphylococcus aureus A10102 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585143.3.peg.1675 Staphylococcus aureus subsp. aureus 55/2053 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585144.3.peg.1406 Staphylococcus aureus subsp. aureus 58-424 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585145.3.peg.1671 Staphylococcus aureus subsp. aureus 65-1322 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585146.3.peg.1670 Staphylococcus aureus subsp. aureus 68-397 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585147.3.peg.1077 Staphylococcus aureus subsp. aureus A017934/97 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585148.3.peg.993 Staphylococcus aureus subsp. aureus Btn1260 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585149.6.peg.1576 Staphylococcus aureus subsp. aureus C101 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585150.3.peg.1728 Staphylococcus aureus subsp. aureus C160 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585151.3.peg.1400 Staphylococcus aureus subsp. aureus C427 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585153.3.peg.1747 Staphylococcus aureus subsp. aureus E1410 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585154.3.peg.1102 Staphylococcus aureus subsp. aureus EMRSA16 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585156.3.peg.958 Staphylococcus aureus subsp. aureus M1015 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585157.3.peg.911 Staphylococcus aureus subsp. aureus M809 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585158.3.peg.1925 Staphylococcus aureus subsp. aureus M876 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585159.3.peg.1530 Staphylococcus aureus subsp. aureus M899 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585161.3.peg.1693 Staphylococcus aureus subsp. aureus WW2703/97 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|585891.3.peg.1512 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|680649.3.peg.663 Staphylococcus aureus subsp. aureus MR1 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|681288.4.peg.1459 Staphylococcus aureus subsp. aureus ED98 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|703339.3.peg.1454 Staphylococcus aureus 04-02981 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
fig|762962.3.peg.571 Staphylococcus aureus subsp. aureus ATCC 51811 FIG   Heptaprenyl diphosphate synthase component I (EC 2.5.1.30)
gb|ABQ49323.1 Staphylococcus aureus subsp. aureus JH9     hypothetical protein SaurJH9_1529
gb|ABR52408.1 Staphylococcus aureus subsp. aureus JH1     conserved hypothetical protein
gb|EEI95060.1 Staphylococcus aureus subsp. aureus MN8     conserved hypothetical protein
gb|EES54721.1 Staphylococcus aureus subsp. aureus TCH70     conserved hypothetical protein
gb|EES92890.1 Staphylococcus aureus subsp. aureus USA300_TCH959     conserved hypothetical protein
gb|EEV04131.1 Staphylococcus aureus subsp. aureus 55/2053     conserved hypothetical protein
gb|EEV06523.1 Staphylococcus aureus subsp. aureus 65-1322     conserved hypothetical protein
gb|EEV09572.1 Staphylococcus aureus subsp. aureus 68-397     conserved hypothetical protein
gb|EEV11814.1 Staphylococcus aureus subsp. aureus E1410     conserved hypothetical protein
gb|EEV14827.1 Staphylococcus aureus subsp. aureus M876     conserved hypothetical protein
gb|EEV27785.1 Staphylococcus aureus A9781     conserved hypothetical protein
gb|EEV64313.1 Staphylococcus aureus A9763     conserved hypothetical protein
gb|EEV67967.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV73926.1 Staphylococcus aureus A9299     conserved hypothetical protein
gb|EEV74251.1 Staphylococcus aureus A8115     conserved hypothetical protein
gb|EEV76511.1 Staphylococcus aureus A6300     conserved hypothetical protein
gb|EEV79902.1 Staphylococcus aureus A6224     conserved hypothetical protein
gb|EEV85723.1 Staphylococcus aureus A5937     conserved hypothetical protein
gi|13701271 Staphylococcus aureus subsp. aureus N315 NCBI   SA1304
gi|14247243 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147741025 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1529
gi|148267956 Staphylococcus aureus subsp. aureus JH9 NCBI   hypothetical protein SaurJH9_1529
gi|149946472 Staphylococcus aureus subsp. aureus JH1 NCBI   conserved hypothetical protein
gi|150394020 Staphylococcus aureus subsp. aureus JH1 NCBI   hypothetical protein SaurJH1_1559
gi|156721926 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979791 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1460
gi|15924462 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV1472
gi|15927053 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1304
gi|21204530 Staphylococcus aureus subsp. aureus MW2 NCBI   MW1361
gi|21283090 Staphylococcus aureus subsp. aureus MW2 NCBI   hypothetical protein MW1361
gi|227245301 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|227558276 Staphylococcus aureus subsp. aureus MN8 NCBI   conserved hypothetical protein
gi|251802064 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|251814399 Staphylococcus aureus subsp. aureus TCH70 NCBI   conserved hypothetical protein
gi|253315979 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_07502
gi|253724161 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|253732114 Staphylococcus aureus subsp. aureus USA300_TCH959 NCBI   conserved hypothetical protein
gi|255006258 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_07315
gi|257271993 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257275036 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257278953 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257281677 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257284707 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257425536 Staphylococcus aureus subsp. aureus 55/2053 NCBI   conserved hypothetical protein
gi|257428195 Staphylococcus aureus subsp. aureus 65-1322 NCBI   conserved hypothetical protein
gi|257430825 Staphylococcus aureus subsp. aureus 68-397 NCBI   conserved hypothetical protein
gi|257433584 Staphylococcus aureus subsp. aureus E1410 NCBI   conserved hypothetical protein
gi|257436425 Staphylococcus aureus subsp. aureus M876 NCBI   conserved hypothetical protein
gi|257789445 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257795473 Staphylococcus aureus A9781 NCBI   conserved hypothetical protein
gi|257839845 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|257843560 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257849968 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|257850298 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|257853552 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|257857002 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|257862959 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|258413281 Staphylococcus aureus A9763 NCBI   conserved hypothetical protein
gi|258420612 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258426807 Staphylococcus aureus A9299 NCBI   conserved hypothetical protein
gi|258444805 Staphylococcus aureus A8115 NCBI   conserved hypothetical protein
gi|258447361 Staphylococcus aureus A6300 NCBI   conserved hypothetical protein
gi|258449754 Staphylococcus aureus A6224 NCBI   conserved hypothetical protein
gi|258454576 Staphylococcus aureus A5937 NCBI   conserved hypothetical protein
gi|49241788 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein
gi|49244754 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein
gi|49483659 Staphylococcus aureus subsp. aureus MRSA252 NCBI   hypothetical protein SAR1481
gi|49486311 Staphylococcus aureus subsp. aureus MSSA476 NCBI   hypothetical protein SAS1413
img|637092968 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099982 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|637154908 Staphylococcus aureus aureus MRSA252 IMG   hypothetical protein
img|637157636 Staphylococcus aureus aureus MSSA476 IMG   hypothetical protein
img|637299125 Staphylococcus aureus aureus MW2 IMG   hypothetical protein
img|639107860 Staphylococcus aureus aureus JH1 IMG   conserved hypothetical protein
img|640565876 Staphylococcus aureus aureus JH9 IMG   hypothetical protein
img|640779642 Staphylococcus aureus aureus JH1 IMG   hypothetical protein
img|640904204 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_1559 Staphylococcus aureus subsp. aureus JH1 KEGG   hypothetical protein
kegg|saj:SaurJH9_1529 Staphylococcus aureus subsp. aureus JH9 KEGG   hypothetical protein
kegg|sam:MW1361 Staphylococcus aureus subsp. aureus MW2 KEGG   hypothetical protein
kegg|sar:SAR1481   KEGG   hypothetical protein
kegg|sas:SAS1413   KEGG   hypothetical protein
kegg|sau:SA1304   KEGG   hypothetical protein
kegg|sav:SAV1472   KEGG   hypothetical protein
kegg|saw:SAHV_1460 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371996.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV1472
ref|NP_374586.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1304
ref|NP_646178.1 Staphylococcus aureus subsp. aureus MW2 RefSeq   hypothetical protein MW1361
ref|YP_001246899.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   hypothetical protein SaurJH9_1529
ref|YP_001316695.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   hypothetical protein SaurJH1_1559
ref|YP_001442050.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1460
ref|YP_040883.1 Staphylococcus aureus subsp. aureus MRSA252 RefSeq   hypothetical protein SAR1481
ref|YP_043532.1 Staphylococcus aureus subsp. aureus MSSA476 RefSeq   hypothetical protein SAS1413
ref|ZP_03988323.1 Staphylococcus aureus subsp. aureus MN8 RefSeq   conserved hypothetical protein
ref|ZP_04828872.1 Staphylococcus aureus subsp. aureus TCH70 RefSeq   conserved hypothetical protein
ref|ZP_04839192.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_07502
ref|ZP_04866279.1 Staphylococcus aureus subsp. aureus USA300_TCH959 RefSeq   conserved hypothetical protein
ref|ZP_05144859.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_07315
ref|ZP_05601961.1 Staphylococcus aureus subsp. aureus 55/2053 RefSeq   conserved hypothetical protein
ref|ZP_05604593.1 Staphylococcus aureus subsp. aureus 65-1322 RefSeq   conserved hypothetical protein
ref|ZP_05607207.1 Staphylococcus aureus subsp. aureus 68-397 RefSeq   conserved hypothetical protein
ref|ZP_05609942.1 Staphylococcus aureus subsp. aureus E1410 RefSeq   conserved hypothetical protein
ref|ZP_05612472.1 Staphylococcus aureus subsp. aureus M876 RefSeq   conserved hypothetical protein
ref|ZP_05644452.1 Staphylococcus aureus A9781 RefSeq   conserved hypothetical protein
ref|ZP_05681557.1 Staphylococcus aureus A9763 RefSeq   conserved hypothetical protein
ref|ZP_05683554.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05688027.1 Staphylococcus aureus A9299 RefSeq   conserved hypothetical protein
ref|ZP_05693134.1 Staphylococcus aureus A8115 RefSeq   conserved hypothetical protein
ref|ZP_05695505.1 Staphylococcus aureus A6300 RefSeq   conserved hypothetical protein
ref|ZP_05697855.1 Staphylococcus aureus A6224 RefSeq   conserved hypothetical protein
ref|ZP_05702540.1 Staphylococcus aureus A5937 RefSeq   conserved hypothetical protein
tr|A5IT00 Staphylococcus aureus (strain JH9) TrEMBL   Putative uncharacterized protein
tr|A6U1U0 Staphylococcus aureus (strain JH1) TrEMBL   Putative uncharacterized protein
tr|A7X2H8 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|C2K883 Staphylococcus aureus subsp. aureus MN8 TrEMBL   Putative uncharacterized protein
tr|C5N5N7 Staphylococcus aureus subsp. aureus USA300_TCH959 TrEMBL   Putative uncharacterized protein
tr|C5QJA6 Staphylococcus aureus subsp. aureus TCH70 TrEMBL   Putative uncharacterized protein
tr|Q6G991 Staphylococcus aureus (strain MSSA476) TrEMBL   Putative uncharacterized protein
tr|Q6GGT9 Staphylococcus aureus (strain MRSA252) TrEMBL   Putative uncharacterized protein
tr|Q7A0V0 Staphylococcus aureus (strain MW2) TrEMBL   MW1361 protein
tr|Q7A5J2 Staphylococcus aureus (strain N315) TrEMBL   SA1304 protein
tr|Q99U18 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search