The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1390: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: UDP-N-acetylglucosamine:L-malate glycosyltransferase
Translate Function Assignments



Context on contig NC_002745 from base 1493028 to 1504416 (11389 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1387 1495721 1493028 2694 -       1: 10   DinG family ATP-dependent helicase YoaA gene_name|dinG, locus|SA1288, protein_id|NP_374569.1, gi|15927036, geneID|1124126
1388 1496716 1495745 972 - 23     4: 3 12 5 2   Biotin operon repressor / Biotin--protein ligase (EC 6.3.4.9)(EC 6.3.4.10)(EC 6.3.4.11)(EC 6.3.4.15) locus|SA1289, protein_id|NP_374570.1, gi|15927037, geneID|1124127
1389 1497905 1496703 1203 - -14     1: 7   tRNA nucleotidyltransferase, CCA-adding (EC 2.7.7.72) locus|SA1290, protein_id|NP_374571.1, gi|15927038, geneID|1124128
1390 1499052 1497910 1143 - 4     1: 13   UDP-N-acetylglucosamine:L-malate glycosyltransferase locus|SA1291, protein_id|NP_374572.1, gi|15927039, geneID|1124129
1391 1499613 1499296 318 - 243         Uncharacterized protein YpjD locus|SA1292, protein_id|NP_374573.1, gi|15927040, geneID|1124130
1392 1500647 1499949 699 - 335         Putative membrane protease YugP locus|SA1293, protein_id|NP_374574.1, gi|15927041, geneID|1124131
1393 1501288 1500701 588 - 53     1: 1   Uncharacterized protein YpjA locus|SA1294, protein_id|NP_374575.1, gi|15927042, geneID|1124132
1394 1501853 1501278 576 - -11     1: 1   BH1670 unknown conserved protein in B. subtilis locus|SA1295, protein_id|NP_374576.1, gi|15927043, geneID|1124133
1395 1503111 1501867 1245 - 13     1: 1   TPR domain protein locus|SA1296, protein_id|NP_374577.1, gi|15927044, geneID|1124134
1396 1504416 1503118 1299 - 6     5: 9 4 6 11 8   5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19) alpha sub-homology division gene_name|aroA, locus|SA1297, protein_id|NP_374578.1, gi|15927045, geneID|1124135

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Exopolysaccharide_Biosynthesis OlgaZ Glycosyl transferase, group 1 family protein


  Protein Sequence

>fig|158879.11.peg.1390 UDP-N-acetylglucosamine:L-malate glycosyltransferase
MKIGITCYPSMGGSGIIATELGIKLAERGHEVHFITSNIPFRIRKPLPNMIFHQVEVNQY
AVFQYPPYDITLSTKIAEVIKEYDLDLLHMHYAVPHAICGILAREMSGKDIKIMTTLHGT
DITVLGYDHSLQGAIKFGIEKSDIVTSVSKSLAQETHEIIETNKEIIPIYNFVRENEFPT
KHNTALKSQFGIAPDEKVLIHVSNFRQVKRIDTIIETFAKVREKIPSKLILLGDGPELVP
MRQLTKELNVEEDVLFLGKQDCVSEFYQLSDLVLLLSEKESFGLTLLEAMKTGVVPIGSN
AGGIKEVIKHGETGFVVDVGDCDSASDYAIRLLEDKALYNKLQKNMLADIAERFGSELIT
DQYEYYYQKMLNEHNKSKGE

MD5 = b01f0a2c70afd720e126aac227ef7c6e


  DNA Sequence

>fig|158879.11.peg.1390 UDP-N-acetylglucosamine:L-malate glycosyltransferase
atgaagataggtataacatgttacccgtccatgggtggttctggaattattgccacagaa
ttaggaattaaattagcagagcgaggtcacgaagtacattttatcacttcaaatatcccg
tttagaataagaaaaccattgccgaatatgatttttcatcaagttgaagtgaatcaatat
gcagtatttcaatatccaccgtatgatattacgttaagtactaaaatcgctgaagttatt
aaagaatatgatcttgatttgttgcatatgcactatgctgtacctcatgcaatttgtgga
attttagctcgtgagatgtcaggtaaagatataaaaattatgacaacgctacacggtact
gatattactgttttgggctatgatcattcactccaaggtgcaattaaatttggcattgaa
aaaagtgatattgtgacaagtgtgagtaaatctttagcgcaagaaacacatgaaattatc
gaaactaacaaagaaattataccgatttataattttgtacgtgaaaatgagtttccaact
aaacataacacagcattaaaatcacaatttggtatagcaccagatgaaaaagtgttaata
catgtatcgaattttagacaagtaaaacgcatagatactattatagaaacatttgcaaaa
gtacgtgaaaagatacctagtaaattaattttacttggagatggtcctgaattagtgcca
atgcgtcaattgacgaaagagttaaacgtagaagaggatgttttatttttagggaaacaa
gattgtgtaagtgaattttatcaattatctgacttagtattattattaagtgaaaaagaa
agctttggactaactttacttgaggctatgaaaacaggcgtcgttccaattggttcaaat
gccggtggaattaaagaggttattaaacatggtgaaactggatttgttgtagatgtgggt
gattgtgattcagcgagtgactatgctatccgtttacttgaagataaggcgttatacaac
aaacttcagaaaaacatgctagcagatattgctgaacgttttggatcagaacttattaca
gatcaatatgagtattattatcaaaaaatgctaaatgagcataacaaaagtaaaggcgag
taa


  DNA with Flanking Sequence

>fig|158879.11.peg.1390 UDP-N-acetylglucosamine:L-malate glycosyltransferase
gatatttttcaccattagctaacttagctagattgactgaagaagtgggcgaacttgcac
gtgaaataaatcatacctatggtgaaaaaaagaagaaagattcagaggaagcaaatacga
ttaaagcagaattaggtgataatttatttgtgttgttatgtttagcgaattcaatgggaa
tagatatgacagagagctttaatgaaacaatggaaaagtttaatacaagagataaaaatc
gattcgaaagaaagtgaatttaaaaatatatgctttatttggatttgattaagattaaaa
acatagaccaatgaattgcatcgcatgaaattatattatttttaaagtaagtagaactag
ataaatgattatatatacaacacctgttttttagatatttgaaattataaactcaacatt
actataaacttaaatttaaacaattatctacgcatcgagaataatagaaagagaaataga
aagaaaggatgggcaagcgaatgaagataggtataacatgttacccgtccatgggtggtt
ctggaattattgccacagaattaggaattaaattagcagagcgaggtcacgaagtacatt
ttatcacttcaaatatcccgtttagaataagaaaaccattgccgaatatgatttttcatc
aagttgaagtgaatcaatatgcagtatttcaatatccaccgtatgatattacgttaagta
ctaaaatcgctgaagttattaaagaatatgatcttgatttgttgcatatgcactatgctg
tacctcatgcaatttgtggaattttagctcgtgagatgtcaggtaaagatataaaaatta
tgacaacgctacacggtactgatattactgttttgggctatgatcattcactccaaggtg
caattaaatttggcattgaaaaaagtgatattgtgacaagtgtgagtaaatctttagcgc
aagaaacacatgaaattatcgaaactaacaaagaaattataccgatttataattttgtac
gtgaaaatgagtttccaactaaacataacacagcattaaaatcacaatttggtatagcac
cagatgaaaaagtgttaatacatgtatcgaattttagacaagtaaaacgcatagatacta
ttatagaaacatttgcaaaagtacgtgaaaagatacctagtaaattaattttacttggag
atggtcctgaattagtgccaatgcgtcaattgacgaaagagttaaacgtagaagaggatg
ttttatttttagggaaacaagattgtgtaagtgaattttatcaattatctgacttagtat
tattattaagtgaaaaagaaagctttggactaactttacttgaggctatgaaaacaggcg
tcgttccaattggttcaaatgccggtggaattaaagaggttattaaacatggtgaaactg
gatttgttgtagatgtgggtgattgtgattcagcgagtgactatgctatccgtttacttg
aagataaggcgttatacaacaaacttcagaaaaacatgctagcagatattgctgaacgtt
ttggatcagaacttattacagatcaatatgagtattattatcaaaaaatgctaaatgagc
ataacaaaagtaaaggcgagtaataatatggataaatcattatttgaacaggcaaggcct
atattagaacaaattcaagacaatggttttgaagcatattatgtaggtggctctgtaaga
gattatgtcatgggaagaaatattcatgatatagatatcacaacaagtgcaacgccggat
gaaatagaatctatctttagtcatacgatacctgtaggtaaagaacatggcaccataaat
gtagtttttaatgatgaaaattatgaagtgacaacattccgggctgaagaagattatgtc
gatcaccgtagaccaagtggtgttacatttgttcgggatttatacgaagatttgcaacga
agagatttcacgatgaatgcgatagcaatggatacagcatacaaattgtatgattatttt
gatggtcaacaagatattaataatcgaataataagaactgtaggtatagctgaggaacga
ttccaagaagatgctttacgtatgattcgatgtttaagattcc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0009058       P:biosynthetic process
GO:0016740       F:transferase activity
cmr|NT01SA1412 Staphylococcus aureus N315     glycosyl transferase, group 1
cmr|NT02SA1447 Staphylococcus aureus Mu50     glycosyl transferase, group 1 family protein
dbj|BAB42551.1 Staphylococcus aureus subsp. aureus N315     SA1291
dbj|BAB57620.1 Staphylococcus aureus subsp. aureus Mu50     lipopolysaccharide biosynthesis-related pr-like protein
dbj|BAF78329.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.1458 Staphylococcus aureus subsp. aureus Mu50 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|158879.1.peg.1334 Staphylococcus aureus subsp. aureus N315 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|359786.13.peg.1605 Staphylococcus aureus subsp. aureus JH9 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|359786.3.peg.202 Staphylococcus aureus subsp. aureus JH9 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|359787.11.peg.1585 Staphylococcus aureus subsp. aureus JH1 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|418127.6.peg.1483 Staphylococcus aureus subsp. aureus Mu3 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|553581.3.peg.30 Staphylococcus aureus A9299 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|553596.3.peg.2413 Staphylococcus aureus A9781 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|585891.3.peg.1499 Staphylococcus aureus subsp. aureus Mu50-omega FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|681288.4.peg.1446 Staphylococcus aureus subsp. aureus ED98 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
fig|703339.3.peg.1441 Staphylococcus aureus 04-02981 FIG   UDP-N-acetylglucosamine:L-malate glycosyltransferase
gb|ABQ49311.1 Staphylococcus aureus subsp. aureus JH9     glycosyl transferase, group 1
gb|ABR52395.1 Staphylococcus aureus subsp. aureus JH1     glycosyl transferase group 1
gb|EEV27798.1 Staphylococcus aureus A9781     glycosyl transferase
gb|EEV64327.1 Staphylococcus aureus A9763     glycosyl transferase
gb|EEV67953.1 Staphylococcus aureus A9719     glycosyl transferase group 1
gb|EEV76524.1 Staphylococcus aureus A6300     glycosyl transferase
gi|13701256 Staphylococcus aureus subsp. aureus N315 NCBI   SA1291
gi|14247229 Staphylococcus aureus subsp. aureus Mu50 NCBI   lipopolysaccharide biosynthesis-related pr-like protein
gi|147741013 Staphylococcus aureus subsp. aureus JH9 NCBI   glycosyl transferase, group 1
gi|148267944 Staphylococcus aureus subsp. aureus JH9 NCBI   glycosyl transferase, group 1
gi|149946459 Staphylococcus aureus subsp. aureus JH1 NCBI   glycosyl transferase group 1
gi|150394007 Staphylococcus aureus subsp. aureus JH1 NCBI   glycosyl transferase group 1
gi|156721912 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156979777 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_1446
gi|15924448 Staphylococcus aureus subsp. aureus Mu50 NCBI   lipopolysaccharide biosynthesis-related pr-like protein
gi|15927039 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA1291
gi|253315967 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_07432
gi|255006245 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_07250
gi|257789458 Staphylococcus aureus A9781 NCBI   glycosyl transferase
gi|257795486 Staphylococcus aureus A9781 NCBI   glycosyl transferase
gi|257839859 Staphylococcus aureus A9763 NCBI   glycosyl transferase
gi|257843546 Staphylococcus aureus A9719 NCBI   glycosyl transferase group 1
gi|257853565 Staphylococcus aureus A6300 NCBI   glycosyl transferase
gi|258413295 Staphylococcus aureus A9763 NCBI   glycosyl transferase
gi|258420598 Staphylococcus aureus A9719 NCBI   glycosyl transferase group 1
gi|258447374 Staphylococcus aureus A6300 NCBI   glycosyl transferase
img|637092954 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637099968 Staphylococcus aureus aureus Mu50 IMG   lipopolysaccharide biosynthesis-related pr-like protein
img|640565864 Staphylococcus aureus aureus JH9 IMG   glycosyl transferase, group 1
img|640779629 Staphylococcus aureus aureus JH1 IMG   glycosyl transferase group 1
img|640904190 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_1546 Staphylococcus aureus subsp. aureus JH1 KEGG   glycosyl transferase group 1
kegg|saj:SaurJH9_1517 Staphylococcus aureus subsp. aureus JH9 KEGG   glycosyl transferase, group 1
kegg|sau:SA1291   KEGG   hypothetical protein
kegg|sav:SAV1458   KEGG   lipopolysaccharide biosynthesis-related pr-like protein
kegg|saw:SAHV_1446 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_371982.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   lipopolysaccharide biosynthesis-related pr-like protein
ref|NP_374572.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA1291
ref|YP_001246887.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   glycosyl transferase, group 1
ref|YP_001316682.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   glycosyl transferase group 1
ref|YP_001442036.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_1446
ref|ZP_04839180.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_07432
ref|ZP_05144846.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_07250
ref|ZP_05644465.1 Staphylococcus aureus A9781 RefSeq   glycosyl transferase
ref|ZP_05681571.1 Staphylococcus aureus A9763 RefSeq   glycosyl transferase
ref|ZP_05683540.1 Staphylococcus aureus A9719 RefSeq   glycosyl transferase group 1
ref|ZP_05695518.1 Staphylococcus aureus A6300 RefSeq   glycosyl transferase
tr|A5ISY8 Staphylococcus aureus (strain JH9) TrEMBL   Glycosyl transferase, group 1
tr|A6U1S7 Staphylococcus aureus (strain JH1) TrEMBL   Glycosyl transferase group 1
tr|A7X2F7 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A5K1 Staphylococcus aureus (strain N315) TrEMBL   SA1291 protein
tr|Q99U31 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Lipopolysaccharide biosynthesis-related pr-like protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search