The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1343: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: FIG01108781: hypothetical protein
Translate Function Assignments



Context on contig NC_002745 from base 1419176 to 1430000 (10825 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1339 1421908 1419176 2733 -       4: 10 9 5 4   2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2) gene_name|sucA, locus|SA1245, protein_id|NP_374526.1, gi|15926993, geneID|1124084
1340 1423547 1422192 1356 - 283       dlit(11454217)
dlit(16030226)
dlit(10633099)
dlit(15528666)
Two component system histidine kinase ArlS gene_name|arlS, locus|SA1246, protein_id|NP_374527.1, gi|15926994, geneID|1124085
1341 1423789 1423544 246 - -4         Putative response regulator ArlR locus|SA1247, protein_id|NP_374528.1, gi|15926995, geneID|3251084
1342 1424187 1423786 402 - -4         Putative response regulator ArlR locus|SA1248, protein_id|NP_374529.1, gi|15926996, geneID|1124086
1343 1424864 1424658 207 - 470         FIG01108781: hypothetical protein locus|SA1249, protein_id|NP_374530.1, gi|15926997, geneID|1124087
1344 1425589 1424975 615 - 110     1: 7   Putative membrane-associated phospholipid phosphatase, PAP2 superfamily locus|SA1250, protein_id|NP_374531.1, gi|15926998, geneID|1124088
1345 1426676 1425606 1071 - 16     5: 2 3 1 6 8   Undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase (EC 2.4.1.227) gene_name|murG, locus|SA1251, protein_id|NP_374532.1, gi|15926999, geneID|1124089
1346 1427197 1426688 510 - 11         Acetyltransferase, GNAT family locus|SA1252, protein_id|NP_374533.1, gi|15927000, geneID|1124090
1347 1429087 1427597 1491 - 399         Carboxyl-terminal protease (EC 3.4.21.102) gene_name|ctpA, locus|SA1253, protein_id|NP_374534.1, gi|15927001, geneID|1124091
1348 1429500 1429279 222 - 191         UPF0346 protein YozE locus|SA1254, protein_id|NP_374535.1, gi|15927002, geneID|1124092
1349 1430000 1429500 501 - -1         PTS system, IIA component YpqE locus|SA1255, protein_id|NP_374536.1, gi|15927003, geneID|1124093

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|158879.11.peg.1343 FIG01108781: hypothetical protein
MKMTNPTRTKRCGGDVLCGIDNHFQLLLYISENHCQLETKTFFEYFLRIVNKTHDYAILE
NKKICISH

MD5 = e8949edc3bbcd28ebc97e4933069b5c8


  DNA Sequence

>fig|158879.11.peg.1343 FIG01108781: hypothetical protein
ttgaaaatgaccaatccaacaagaacgaaacgttgtgggggggatgttctatgtggtatt
gataatcattttcaactactattatacattagtgagaatcattgtcaattagaaactaaa
actttttttgaatattttttaagaatagtaaataaaacgcatgattacgctattttagaa
aataaaaaaatttgtatttctcattag


  DNA with Flanking Sequence

>fig|158879.11.peg.1343 FIG01108781: hypothetical protein
atgttaaagcgccacaaaattgaagcattattttttgcattaacaatggcactatctgga
attttgaatccagcattaaaaaatatattcgatagagaaagacctacattgctgcgttta
attgatataacaggatttagttttcctagcggtcatgctatgggatcaactgcatatttt
ggaagtggtatctatctattaaatcgattaaatcaaggtaattcaaaaggtattcttata
gggttatgtgcagctatgattttattgatttccatatcacgtgtatatctaggtgtacat
tatccaacagatattattgccggcattattggtggcgtattttgcattattttatcaacg
ttattacttagaaataaattaataaattaaatagtaaaaaaacaaaagcagtaaacctaa
agtgtcgtaagggtttactgcttttataaaacgttgttataacgtatattgtcttttacg
ggcatataaaaggggaatatttgaaaatgaccaatccaacaagaacgaaacgttgtgggg
gggatgttctatgtggtattgataatcattttcaactactattatacattagtgagaatc
attgtcaattagaaactaaaactttttttgaatattttttaagaatagtaaataaaacgc
atgattacgctattttagaaaataaaaaaatttgtatttctcattagaattagaatattt
aaaagttatgaggtttaaaaattatattgtttacatactccttttgaatttatacattat
gaaatgttacttccaagttcaaaatcgcacattgaaatgatgtgtgaaaatgtttaaact
acggtcattttgtgaaaataaagataataactattcattttacaatagtgaaaagtcagt
atatgacaacaattaatattgcggtaaggccttgtgttacagtattctatatttaagtac
tgcaatcagaattaacagaatgccattaactgattattaaatatttgagttaataaataa
ttaatgattgtagcttgaaaaatttaaaacatggttattgatttgtgataaaatttaaac
gtaaacaaactaatttaaaaagcaactattgtatagaaaaatacaaaatttaaaatatat
taccttattagaaaaagtcgtaatatgaggtgtacaaatgacgcaaattttaatagtaga
agatgaa


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
fig|158878.14.peg.1455 Staphylococcus aureus subsp. aureus Mu50 FIG   FIG01108781: hypothetical protein
fig|418127.6.peg.1437 Staphylococcus aureus subsp. aureus Mu3 FIG   FIG01108781: hypothetical protein
fig|426430.8.peg.1444 Staphylococcus aureus subsp. aureus str. Newman FIG   FIG01108781: hypothetical protein
fig|450394.6.peg.658 Staphylococcus aureus subsp. aureus USA300_TCH959 FIG   FIG01108781: hypothetical protein
fig|505321.3.peg.725 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   FIG01108781: hypothetical protein
fig|548474.3.peg.892 Staphylococcus aureus subsp. aureus TCH130 FIG   FIG01108781: hypothetical protein
fig|553565.3.peg.1378 Staphylococcus aureus A5937 FIG   FIG01108781: hypothetical protein
fig|553567.3.peg.2248 Staphylococcus aureus A5948 FIG   FIG01108781: hypothetical protein
fig|553573.3.peg.2617 Staphylococcus aureus A8115 FIG   FIG01108781: hypothetical protein
fig|553574.3.peg.261 Staphylococcus aureus A8117 FIG   FIG01108781: hypothetical protein
fig|553581.3.peg.778 Staphylococcus aureus A9299 FIG   FIG01108781: hypothetical protein
fig|553596.3.peg.2457 Staphylococcus aureus A9781 FIG   FIG01108781: hypothetical protein
fig|585891.3.peg.1452 Staphylococcus aureus subsp. aureus Mu50-omega FIG   FIG01108781: hypothetical protein
fig|680649.3.peg.608 Staphylococcus aureus subsp. aureus MR1 FIG   FIG01108781: hypothetical protein
fig|681288.4.peg.1398 Staphylococcus aureus subsp. aureus ED98 FIG   FIG01108781: hypothetical protein
fig|703339.3.peg.1396 Staphylococcus aureus 04-02981 FIG   FIG01108781: hypothetical protein
fig|93061.5.peg.1300 Staphylococcus aureus subsp. aureus NCTC 8325 FIG   FIG01108781: hypothetical protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search