The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.130: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Exopolysaccharide biosynthesis glycosyltransferase EpsF
Translate Function Assignments



Context on contig NC_002745 from base 138019 to 150675 (12657 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
123 138019 139221 1203 +       1: 1 dlit(14688077) 2-[(L-alanin-3-ylcarbamoyl)methyl]-2-hydroxybutanedioate decarboxylase (EC 4.1.1.117) locus|SA0119, protein_id|NP_373360.1, gi|15925827, geneID|1122893
124 139225 139989 765 + 3     1: 1 dlit(14688077) L-serine kinase (ATP) (EC 2.7.1.225) locus|SA0120, protein_id|NP_373361.1, gi|15925828, geneID|1122894
125 140185 140811 627 + 195         FIG01108113: hypothetical protein locus|SA0121, protein_id|NP_373362.1, gi|15925829, geneID|1122895
126 141023 141799 777 + 211     1: 4   2,3-butanediol dehydrogenase, S-alcohol forming, (R)-acetoin-specific (EC 1.1.1.4) @ Diacetyl reductase [(S)-acetoin forming] (EC 1.1.1.304) gene_name|butA, locus|SA0122, protein_id|NP_373363.1, gi|15925830, geneID|1122896
127 142000 141848 153 - 48         FIG01108063: hypothetical protein locus|SAS004, protein_id|NP_373364.1, gi|15925831, geneID|1122897
128 142144 143115 972 + 143         UDP-glucose 4-epimerase (EC 5.1.3.2) locus|SA0123, protein_id|NP_373365.1, gi|15925832, geneID|1122898
129 143186 143770 585 + 70         Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase; teichuronic acid biosynthesis glycosyltransferase TuaA locus|SA0124, protein_id|NP_373366.1, gi|15925833, geneID|1122899
130 143980 145146 1167 + 209     1: 11   Exopolysaccharide biosynthesis glycosyltransferase EpsF locus|SA0125, protein_id|NP_373367.1, gi|15925834, geneID|1122900
131 145127 146365 1239 + -20         Teichuronic acid biosynthesis protein TuaE, putative secreted polysaccharide polymerase locus|SA0126, protein_id|NP_373368.1, gi|15925835, geneID|1122901
132 146355 147785 1431 + -11     1: 3   Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids locus|SA0127, protein_id|NP_373369.1, gi|15925836, geneID|1122902
133 148053 148652 600 + 267     6: 5 7 9 8 10 6 dlit(7557308)
dlit(11948161)
dlit(14523108)
Superoxide dismutase [Mn] (EC 1.15.1.1); Superoxide dismutase [Fe] (EC 1.15.1.1) gene_name|sodM, locus|SA0128, protein_id|NP_373370.1, gi|15925837, geneID|1122903
134 149019 149744 726 + 366     1: 2   Predicted cell-wall-anchored protein SasD (LPXAG motif) locus|SA0129, protein_id|NP_373371.1, gi|15925838, geneID|1122904
135 150675 149935 741 - 190         Predicted regulator for deoxynucleoside utilization, GntR family locus|SA0130, protein_id|NP_373372.1, gi|15925839, geneID|1122905

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Exopolysaccharide_Biosynthesis OlgaZ Exopolysaccharide biosynthesis glycosyltransferase EpsF (EC 2.4.1.-)


  Protein Sequence

>fig|158879.11.peg.130 Exopolysaccharide biosynthesis glycosyltransferase EpsF
MKIIYCITKADNGGAQTHLIQLANHFCVHHDVYVIVGNHGPMIEQLDARVNVIILEHLVG
PIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFISKSKDTRVVFTAHGWAF
TEGVKPAKKFLYLVIEKLMSCITDSIICVSDFDKQLALKYRFNRLKLTTIHNGIADVPAV
KQTLKSQSHNNIGEVVGMLPNKQDLQINAPTKHQFVMIARFAYPKLPQNLIAAIEILKLH
NSNHAHFTFIGDGPTLNDCQQQVVQAGLENDVTFLGNVINASHLLSQYDTFILISKHEGL
PISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPETIAKVLEKYLIDSDYIKMSNQ
SRKRYLECFTEEKMIKEVEDVYNGKSTQ

MD5 = 44118a5c7c3bb1ed309a434f9d561ad8


  DNA Sequence

>fig|158879.11.peg.130 Exopolysaccharide biosynthesis glycosyltransferase EpsF
ttgaaaattatatattgtattactaaagcagacaatggtggtgcacaaacacatctcatt
caactcgccaaccatttttgcgtacaccatgatgtttatgtcattgtaggcaatcatgga
ccaatgattgaacaactagatgcaagagttaatgtaattattctcgaacatttagtaggt
ccaattgactttaaacaagatattttagctgtcaaagtgttagcacagttattctcgaaa
attaagcctgatgttatccatttacattcttccaaagctggaacggtcggacgaattgcg
aagttcatttcgaaatcgaaagacacacgtgtagtttttactgcgcatggatgggctttt
acagagggtgttaaaccagctaaaaaatttctatatctagttatcgaaaaattaatgtca
tgtattacagatagcattatttgtgtttcagatttcgataaacagttagcgttaaaatat
cgatttaatcgattgaaattaaccacaatacataatggtattgcagatgttcccgctgtt
aagcaaacgctaaaaagccaatcacataacaatattggcgaagtagttggaatgttgcct
aataaacaagatttacagattaatgccccgacaaagcatcaatttgttatgattgcaaga
tttgcttatccaaaattgccacaaaatctaatcgcggcaatagagatattgaaattacat
aacagtaatcatgcgcattttacatttataggcgatggacctacattaaatgattgtcag
caacaagttgtacaagctgggttagaaaatgatgtcacatttttgggcaatgtcattaat
gcgagtcatttattatcacaatacgatacgtttattttaataagtaagcatgaaggtttg
ccaattagcattatagaagctatggctacaggtttgcctgttatagccagtcatgttggc
ggtatttcagaattagtagctgataatggtatatgtatgatgaacaaccaacccgaaact
attgctaaagtcctggaaaaatatttaatagacagtgattacatcaaaatgagtaatcaa
tctagaaaacgttatttagaatgttttactgaggagaaaatgattaaagaagtggaagac
gtttataatggaaaatcaacacaatag


  DNA with Flanking Sequence

>fig|158879.11.peg.130 Exopolysaccharide biosynthesis glycosyltransferase EpsF
ttaccacaactaattaatgttgttaaaggggaaatgagttttattggaccacgcccggaa
cgtccggaatttgtagaattatttagttcagaagtgataggtttcgagcaaagatgtctt
gttacaccagggttaacaggacttgcgcaaattcaaggtggatatgacttaacaccgcaa
caaaaactgaaatatgacatgaaatatatacataaaggtagtttaatgatggaactatat
atatcaattagaacattgatggttgttattacaggggaaggctcaaggtagtcttaattt
acttaataagttcaaataaaagttatattttaaagattgtgaccaattgttacagtataa
cgaggaatcccttgagacagtatcaaatggcattaagaaatatgtgccatcattgatttg
catggctataaatactattcatctgatgagatagccatgttaagaaattgaaagtatagc
attaaaggggtttgtaacagttgaaaattatatattgtattactaaagcagacaatggtg
gtgcacaaacacatctcattcaactcgccaaccatttttgcgtacaccatgatgtttatg
tcattgtaggcaatcatggaccaatgattgaacaactagatgcaagagttaatgtaatta
ttctcgaacatttagtaggtccaattgactttaaacaagatattttagctgtcaaagtgt
tagcacagttattctcgaaaattaagcctgatgttatccatttacattcttccaaagctg
gaacggtcggacgaattgcgaagttcatttcgaaatcgaaagacacacgtgtagttttta
ctgcgcatggatgggcttttacagagggtgttaaaccagctaaaaaatttctatatctag
ttatcgaaaaattaatgtcatgtattacagatagcattatttgtgtttcagatttcgata
aacagttagcgttaaaatatcgatttaatcgattgaaattaaccacaatacataatggta
ttgcagatgttcccgctgttaagcaaacgctaaaaagccaatcacataacaatattggcg
aagtagttggaatgttgcctaataaacaagatttacagattaatgccccgacaaagcatc
aatttgttatgattgcaagatttgcttatccaaaattgccacaaaatctaatcgcggcaa
tagagatattgaaattacataacagtaatcatgcgcattttacatttataggcgatggac
ctacattaaatgattgtcagcaacaagttgtacaagctgggttagaaaatgatgtcacat
ttttgggcaatgtcattaatgcgagtcatttattatcacaatacgatacgtttattttaa
taagtaagcatgaaggtttgccaattagcattatagaagctatggctacaggtttgcctg
ttatagccagtcatgttggcggtatttcagaattagtagctgataatggtatatgtatga
tgaacaaccaacccgaaactattgctaaagtcctggaaaaatatttaatagacagtgatt
acatcaaaatgagtaatcaatctagaaaacgttatttagaatgttttactgaggagaaaa
tgattaaagaagtggaagacgtttataatggaaaatcaacacaatagtaaattactaaca
ttgttacttatcggtttagcggtttttattcagcaatcttcggttattgccggtgtgaat
gtttctatagctgactttatcacattactaatattagtttatttactgtttttcgctaac
catttattaaaggcaaatcattttttacagtttttcattattttgtatacatatcgtatg
attattacgctttgtttgctattttttgatgatttgatatttattacggttaaggaagtt
cttgcatctacagttaaatatgcatttgtagtcatttatttctatttagggatgatcatc
tttaagttaggtaatagcaaaaaagtgatcgttacctcttatattataagcagtgtgact
ataggtctattttgtattatagctggtttgaacaagtcccctttactaatgaaattgtta
tattttgatgaaatacgttcaaaaggattaatgaatgaccctaactatttcgcgatgaca
cagatta


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0009058       P:biosynthetic process
GO:0016740       F:transferase activity
cmr|NT01SA0134 Staphylococcus aureus N315     glycosyl transferase, group 1 family protein domain protein
cmr|NT02SA0127 Staphylococcus aureus Mu50     glycosyltransferase
dbj|BAB41345.1 Staphylococcus aureus subsp. aureus N315     SA0125
dbj|BAB56292.1 Staphylococcus aureus subsp. aureus Mu50     hypothetical protein
dbj|BAF77012.1 Staphylococcus aureus subsp. aureus Mu3     hypothetical protein
fig|158878.1.peg.130 Staphylococcus aureus subsp. aureus Mu50 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|158878.14.peg.128 Staphylococcus aureus subsp. aureus Mu50 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|158879.1.peg.128 Staphylococcus aureus subsp. aureus N315 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|359786.13.peg.156 Staphylococcus aureus subsp. aureus JH9 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|359786.3.peg.1205 Staphylococcus aureus subsp. aureus JH9 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|359787.11.peg.153 Staphylococcus aureus subsp. aureus JH1 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|359787.3.peg.808 Staphylococcus aureus subsp. aureus JH1 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|418127.4.peg.113 Staphylococcus aureus subsp. aureus Mu3 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|418127.6.peg.127 Staphylococcus aureus subsp. aureus Mu3 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|505321.3.peg.1787 Staphylococcus aureus subsp. aureus str. CF-Marseille FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553565.3.peg.2448 Staphylococcus aureus A5937 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553568.3.peg.9 Staphylococcus aureus A6224 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553571.3.peg.177 Staphylococcus aureus A6300 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553573.3.peg.1701 Staphylococcus aureus A8115 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553574.3.peg.1689 Staphylococcus aureus A8117 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553577.3.peg.804 Staphylococcus aureus A8796 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553580.3.peg.540 Staphylococcus aureus A8819 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553581.3.peg.1958 Staphylococcus aureus A9299 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553588.3.peg.159 Staphylococcus aureus A9719 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553592.3.peg.683 Staphylococcus aureus A9763 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553596.3.peg.1374 Staphylococcus aureus A9781 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|553601.3.peg.1869 Staphylococcus aureus A10102 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|585891.3.peg.128 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|680649.3.peg.1297 Staphylococcus aureus subsp. aureus MR1 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|681288.4.peg.97 Staphylococcus aureus subsp. aureus ED98 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
fig|703339.3.peg.131 Staphylococcus aureus 04-02981 FIG   Exopolysaccharide biosynthesis glycosyltransferase EpsF
gb|ABQ47923.1 Staphylococcus aureus subsp. aureus JH9     glycosyl transferase, group 1
gb|ABR50983.1 Staphylococcus aureus subsp. aureus JH1     glycosyl transferase group 1
gb|EEV26791.1 Staphylococcus aureus A9781     glycosyl transferase
gb|EEV65242.1 Staphylococcus aureus A9763     glycosyl transferase
gb|EEV68502.1 Staphylococcus aureus A9719     conserved hypothetical protein
gb|EEV72203.1 Staphylococcus aureus A9299     glycosyl transferase group 1
gb|EEV74718.1 Staphylococcus aureus A8115     glycosyl transferase group 1
gb|EEV78917.1 Staphylococcus aureus A6300     glycosyl transferase group 1
gb|EEV81840.1 Staphylococcus aureus A6224     glycosyl transferase
gb|EEV84667.1 Staphylococcus aureus A5937     glycosyl transferase group 1
gi|13700046 Staphylococcus aureus subsp. aureus N315 NCBI   SA0125
gi|14245897 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein
gi|147739625 Staphylococcus aureus subsp. aureus JH9 NCBI   glycosyl transferase, group 1
gi|148266556 Staphylococcus aureus subsp. aureus JH9 NCBI   glycosyl transferase, group 1
gi|149945047 Staphylococcus aureus subsp. aureus JH1 NCBI   glycosyl transferase group 1
gi|150392595 Staphylococcus aureus subsp. aureus JH1 NCBI   glycosyl transferase group 1
gi|156720595 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein
gi|156978460 Staphylococcus aureus subsp. aureus Mu3 NCBI   hypothetical protein SAHV_0129
gi|15923120 Staphylococcus aureus subsp. aureus Mu50 NCBI   hypothetical protein SAV0130
gi|15925834 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0125
gi|253316256 Staphylococcus aureus subsp. aureus str. CF-Marseille NCBI   hypothetical protein SauraC_08971
gi|255004927 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   hypothetical protein SauraM_00620
gi|257788451 Staphylococcus aureus A9781 NCBI   glycosyl transferase
gi|257794479 Staphylococcus aureus A9781 NCBI   glycosyl transferase
gi|257840785 Staphylococcus aureus A9763 NCBI   glycosyl transferase
gi|257844115 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|257848211 Staphylococcus aureus A9299 NCBI   glycosyl transferase group 1
gi|257850774 Staphylococcus aureus A8115 NCBI   glycosyl transferase group 1
gi|257855998 Staphylococcus aureus A6300 NCBI   glycosyl transferase group 1
gi|257858976 Staphylococcus aureus A6224 NCBI   glycosyl transferase
gi|257861894 Staphylococcus aureus A5937 NCBI   glycosyl transferase group 1
gi|258407560 Staphylococcus aureus A9763 NCBI   glycosyl transferase
gi|258419833 Staphylococcus aureus A9719 NCBI   conserved hypothetical protein
gi|258438652 Staphylococcus aureus A9299 NCBI   glycosyl transferase group 1
gi|258443890 Staphylococcus aureus A8115 NCBI   glycosyl transferase group 1
gi|258445090 Staphylococcus aureus A6300 NCBI   glycosyl transferase group 1
gi|258447694 Staphylococcus aureus A6224 NCBI   glycosyl transferase
gi|258455682 Staphylococcus aureus A5937 NCBI   glycosyl transferase group 1
img|637091725 Staphylococcus aureus aureus N315 IMG   hypothetical protein
img|637098629 Staphylococcus aureus aureus Mu50 IMG   hypothetical protein
img|639109735 Staphylococcus aureus aureus JH1 IMG   Glycosyl transferase, group 1
img|640564446 Staphylococcus aureus aureus JH9 IMG   glycosyl transferase, group 1
img|640778191 Staphylococcus aureus aureus JH1 IMG   glycosyl transferase group 1
img|640902851 Staphylococcus aureus aureus Mu3 IMG   hypothetical protein
kegg|sah:SaurJH1_0121 Staphylococcus aureus subsp. aureus JH1 KEGG   glycosyl transferase group 1
kegg|saj:SaurJH9_0116 Staphylococcus aureus subsp. aureus JH9 KEGG   glycosyl transferase, group 1
kegg|sau:SA0125   KEGG   hypothetical protein
kegg|sav:SAV0130   KEGG   hypothetical protein
kegg|saw:SAHV_0129 Staphylococcus aureus subsp. aureus Mu3 KEGG   hypothetical protein
ref|NP_370654.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   hypothetical protein SAV0130
ref|NP_373367.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0125
ref|YP_001245499.1 Staphylococcus aureus subsp. aureus JH9 RefSeq   glycosyl transferase, group 1
ref|YP_001315270.1 Staphylococcus aureus subsp. aureus JH1 RefSeq   glycosyl transferase group 1
ref|YP_001440719.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   hypothetical protein SAHV_0129
ref|ZP_04839469.1 Staphylococcus aureus subsp. aureus str. CF-Marseille RefSeq   hypothetical protein SauraC_08971
ref|ZP_05143528.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   hypothetical protein SauraM_00620
ref|ZP_05643458.1 Staphylococcus aureus A9781 RefSeq   glycosyl transferase
ref|ZP_05680696.1 Staphylococcus aureus A9763 RefSeq   glycosyl transferase
ref|ZP_05682795.1 Staphylococcus aureus A9719 RefSeq   conserved hypothetical protein
ref|ZP_05689875.1 Staphylococcus aureus A9299 RefSeq   glycosyl transferase group 1
ref|ZP_05692228.1 Staphylococcus aureus A8115 RefSeq   glycosyl transferase group 1
ref|ZP_05693327.1 Staphylococcus aureus A6300 RefSeq   glycosyl transferase group 1
ref|ZP_05695833.1 Staphylococcus aureus A6224 RefSeq   glycosyl transferase
ref|ZP_05703637.1 Staphylococcus aureus A5937 RefSeq   glycosyl transferase group 1
tr|A5IP00 Staphylococcus aureus (strain JH9) TrEMBL   Glycosyl transferase, group 1 precursor
tr|A6TXR5 Staphylococcus aureus (strain JH1) TrEMBL   Glycosyl transferase group 1 precursor
tr|A7WX89 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Putative uncharacterized protein
tr|Q7A857 Staphylococcus aureus (strain N315) TrEMBL   SA0125 protein
tr|Q99X85 Staphylococcus aureus (strain Mu50 / ATCC 700699) TrEMBL   Putative uncharacterized protein


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search