The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.1291: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
Translate Function Assignments



Context on contig NC_002745 from base 1363612 to 1376322 (12711 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1286 1363612 1366134 2523 +       1: 6 dlit(14702396)
dlit(19289517)
dlit(16723576)
L-O-lysylphosphatidylglycerol synthase (EC 2.3.2.3) gene_name|fmtC, locus|SA1193, protein_id|NP_374473.1, gi|15926940, geneID|1124031
1287 1366846 1366337 510 - 202       dlit(11779133) Peptide-methionine (S)-S-oxide reductase MsrA (EC 1.8.4.11) gene_name|msrA, locus|SA1194, protein_id|NP_374474.1, gi|15926941, geneID|1124032
1288 1366983 1367966 984 + 136     1: 6   Peptide methionine sulfoxide reductase regulator MsrR gene_name|msrR, locus|SA1195, protein_id|NP_374475.1, gi|15926942, geneID|1124033
1289 1368242 1368054 189 - 87         2-hydroxymuconate tautomerase-like protein YwhB (Bsu3751) locus|SAS044, protein_id|NP_374476.1, gi|15926943, geneID|1124034
1290 1368387 1369649 1263 + 144         Putative UV-damage repair protein UvrX locus|SA1196, protein_id|NP_374477.1, gi|15926944, geneID|1124035
1291 1370877 1369786 1092 - 136     4: 9 10 11 8   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific gene_name|tyrA, locus|SA1197, protein_id|NP_374478.1, gi|15926945, geneID|1124036
1292 1371042 1372073 1032 + 164     1: 7   Deblocking aminopeptidase locus|SA1198, protein_id|NP_374479.1, gi|15926946, geneID|1124037
1293 1372565 1373971 1407 + 491     5: 1 2 4 3 5   Anthranilate synthase, aminase component (EC 4.1.3.27) locus|SA1199, protein_id|NP_374480.1, gi|15926947, geneID|1124038
1294 1373968 1374534 567 + -4     5: 1 2 4 3 5   Anthranilate synthase, amidotransferase component (EC 4.1.3.27) gene_name|trpG, locus|SA1200, protein_id|NP_374481.1, gi|15926948, geneID|1124039
1295 1374540 1375538 999 + 5     5: 1 2 4 3 5   Anthranilate phosphoribosyltransferase (EC 2.4.2.18) gene_name|trpD, locus|SA1201, protein_id|NP_374482.1, gi|15926949, geneID|1124040
1296 1375540 1376322 783 + 1     5: 1 2 4 3 5   Indole-3-glycerol phosphate synthase (EC 4.1.1.48) gene_name|trpC, locus|SA1202, protein_id|NP_374483.1, gi|15926950, geneID|1124041

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Chorismate_Synthesis VeronikaV Prephenate dehydrogenase (EC 1.3.1.12)
Phenylalanine_and_Tyrosine_Branches_from_Chorismate carolb Prephenate dehydrogenase (EC 1.3.1.12)
Major_Facilitator_Transporter Blaby_Crysten_user Prephenate dehydrogenase (EC 1.3.1.12)
Phenylalanine_and_Tyrosine_biosynthesis_PanGenomes Acharya_Geeta_user Prephenate dehydrogenase (EC 1.3.1.12)


  Protein Sequence

>fig|158879.11.peg.1291 Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIK
KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHESNLLKHNIHLVSGH
PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
IPDESGMISKVTYIMSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
YIQ

MD5 = 7084618beaa1b985e4a3f8da50dffcdc


  DNA Sequence

>fig|158879.11.peg.1291 Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
atgacaacagttttatttgttggacttggattaattggtggaagtcttgctagcaatata
aaataccataaccctaatactaatattattgcatacgatgcagatacttctcagttagat
aaagctaaatcaatcggcattattaatgaaaaatgtttaaattatagtgaagctattaaa
aaagccgatgtaattatttatgcaacacctgttgctatcacaaataaatatcttagcgag
cttatagatatgccaactaaacctggtgttattgtttctgatactggtagtactaaagca
atgatacagcaacacgaatccaatttattaaagcataatattcatttagtcagtggtcat
ccaatggctggtagtcataaatctggtgtactaaatgctaaaaagcacttatttgaaaac
gcttattatattttagtctataatgagccaagaaatgagcaagcagcaaacacgttaaaa
gaactgttatcacctactcttgctaaatttattgtaactactgctgaagaacacgactac
gtaacaagcgtcgtaagtcatttacctcatatcgttgcatctagtttagttcatgttagt
caaaagaacggtcaagaacatcatttagttaataaacttgcagctggtggttttcgtgat
atcactcgtatagctagtagtaatgcacaaatgtggaaagatatcaccttgagtaataaa
acgtatattttagaaatgattcgacagctaaaaagtcagtttcaagatttagaaagacta
attgaaagcaatgattctgaaaaattgttatcattttttgcccaagctaaatcgtatcgc
gacgcactacccgctaaacaactaggtggactaaatactgcgtatgatctatatgtagat
attccggatgaatcaggtatgataagtaaagtgacttatatcatgagtttacataacata
tctataagcaacttaagaatcttagaagtacgcgaagatatatacggtgctttaaaaatt
agtttcaaaaatcctactgaccgagaacgcggtatgcaagcattgagtgattttgattgt
tatatccaataa


  DNA with Flanking Sequence

>fig|158879.11.peg.1291 Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
tcctgtatatatttgaccagcatcagttttaatttggcaatattcaccctcaatcgcgtt
atacgtgaatcctccaattaattctattgctaagcgaccatcttctttaatttctttaac
cattgcacctaaagtatcaacatgagcagtaatacagcgttgtacttcatcatttttgcc
tggcactgttattaataacgcacctttatttgttagtgttgtttgataacccaagtcttt
tgcatatttttcgacaaattgaattgcttcttctgtgtctcctgaaggactattaatacc
tgttaatgttttaatcatttctaatattggttccattgatttacccctccgttgccattg
tgttactatactctttattgtagatgatttatctccgtttatctattaatgctattatcg
atttttatttactattgcactgtgtcaacagctcatttacaatgttattattctgaaaat
ttcgaaataaggtgatttatatgacaacagttttatttgttggacttggattaattggtg
gaagtcttgctagcaatataaaataccataaccctaatactaatattattgcatacgatg
cagatacttctcagttagataaagctaaatcaatcggcattattaatgaaaaatgtttaa
attatagtgaagctattaaaaaagccgatgtaattatttatgcaacacctgttgctatca
caaataaatatcttagcgagcttatagatatgccaactaaacctggtgttattgtttctg
atactggtagtactaaagcaatgatacagcaacacgaatccaatttattaaagcataata
ttcatttagtcagtggtcatccaatggctggtagtcataaatctggtgtactaaatgcta
aaaagcacttatttgaaaacgcttattatattttagtctataatgagccaagaaatgagc
aagcagcaaacacgttaaaagaactgttatcacctactcttgctaaatttattgtaacta
ctgctgaagaacacgactacgtaacaagcgtcgtaagtcatttacctcatatcgttgcat
ctagtttagttcatgttagtcaaaagaacggtcaagaacatcatttagttaataaacttg
cagctggtggttttcgtgatatcactcgtatagctagtagtaatgcacaaatgtggaaag
atatcaccttgagtaataaaacgtatattttagaaatgattcgacagctaaaaagtcagt
ttcaagatttagaaagactaattgaaagcaatgattctgaaaaattgttatcattttttg
cccaagctaaatcgtatcgcgacgcactacccgctaaacaactaggtggactaaatactg
cgtatgatctatatgtagatattccggatgaatcaggtatgataagtaaagtgacttata
tcatgagtttacataacatatctataagcaacttaagaatcttagaagtacgcgaagata
tatacggtgctttaaaaattagtttcaaaaatcctactgaccgagaacgcggtatgcaag
cattgagtgattttgattgttatatccaataattattaagtctcttttgataaattccca
tgtattcttagatattattgtgaaatctattgtgatatatgaaatatttatctttagaga
cttattttatacgaatcacagttatatattccttaaaccgtatagtcattacattttatg
tccagccattaaacctaatctaccatgttttgtacctgcttctgtaaacgatactgcttt
ggacacaatacctttgccgtatttcaaatgtaattggtctatcgttttagctaggcattc
gtcacgtttgcgttggtattcatcttcaaacagacttaactgtcgctcatcctcattaat
aaattgactcaaagatatacttagcgtacgatatagtgcttgtttattacataatttatc
tgcaaaatgcattactactttataaatatctttttctaagtttgttggatctttcaaagt
atattgcttatgtacaccgccttcatcactatagccaaaggcaaaatgtatc


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004665       F:prephenate dehydrogenase (NADP+) activity
GO:0005488       F:binding
GO:0006571       P:tyrosine biosynthetic process
GO:0008977       F:prephenate dehydrogenase activity
GO:0055114       P:oxidation reduction
cmr|NT01SA1313 Staphylococcus aureus N315     prephenate dehydrogenase [imported]
cmr|NT02SA1355 Staphylococcus aureus Mu50     prephenate dehydrogenase
dbj|BAB42457.1 Staphylococcus aureus subsp. aureus N315     prephenate dehydrogenase
dbj|BAB57527.1 Staphylococcus aureus subsp. aureus Mu50     prephenate dehydrogenase
dbj|BAF78236.1 Staphylococcus aureus subsp. aureus Mu3     prephenate dehydrogenase
fig|158878.1.peg.1365 Staphylococcus aureus subsp. aureus Mu50 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|158878.14.peg.1404 Staphylococcus aureus subsp. aureus Mu50 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|158879.1.peg.1240 Staphylococcus aureus subsp. aureus N315 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|418127.6.peg.1384 Staphylococcus aureus subsp. aureus Mu3 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553565.3.peg.1429 Staphylococcus aureus A5937 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553568.3.peg.1623 Staphylococcus aureus A6224 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553571.3.peg.2510 Staphylococcus aureus A6300 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553573.3.peg.2566 Staphylococcus aureus A8115 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553574.3.peg.210 Staphylococcus aureus A8117 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553581.3.peg.829 Staphylococcus aureus A9299 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553592.3.peg.1703 Staphylococcus aureus A9763 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|553601.3.peg.2307 Staphylococcus aureus A10102 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|585891.3.peg.1401 Staphylococcus aureus subsp. aureus Mu50-omega FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
fig|703339.3.peg.1345 Staphylococcus aureus 04-02981 FIG   Prephenate dehydrogenase (EC 1.3.1.12) # TyrAp/ACT domain, NAD-specific
gb|EEV64421.1 Staphylococcus aureus A9763     prephenate dehydrogenase
gb|EEV73066.1 Staphylococcus aureus A9299     prephenate dehydrogenase
gb|EEV74147.1 Staphylococcus aureus A8115     prephenate dehydrogenase
gb|EEV76614.1 Staphylococcus aureus A6300     prephenate dehydrogenase
gb|EEV80191.1 Staphylococcus aureus A6224     prephenate dehydrogenase
gb|EEV85832.1 Staphylococcus aureus A5937     prephenate dehydrogenase
gi|13701162 Staphylococcus aureus subsp. aureus N315 NCBI   prephenate dehydrogenase
gi|14247136 Staphylococcus aureus subsp. aureus Mu50 NCBI   prephenate dehydrogenase
gi|156721819 Staphylococcus aureus subsp. aureus Mu3 NCBI   prephenate dehydrogenase
gi|156979684 Staphylococcus aureus subsp. aureus Mu3 NCBI   prephenate dehydrogenase
gi|15924355 Staphylococcus aureus subsp. aureus Mu50 NCBI   prephenate dehydrogenase
gi|15926945 Staphylococcus aureus subsp. aureus N315 NCBI   prephenate dehydrogenase
gi|255006154 Staphylococcus aureus subsp. aureus Mu50-omega NCBI   prephenate dehydrogenase
gi|257839953 Staphylococcus aureus A9763 NCBI   prephenate dehydrogenase
gi|257849084 Staphylococcus aureus A9299 NCBI   prephenate dehydrogenase
gi|257850194 Staphylococcus aureus A8115 NCBI   prephenate dehydrogenase
gi|257853655 Staphylococcus aureus A6300 NCBI   prephenate dehydrogenase
gi|257857293 Staphylococcus aureus A6224 NCBI   prephenate dehydrogenase
gi|257863068 Staphylococcus aureus A5937 NCBI   prephenate dehydrogenase
gi|258413389 Staphylococcus aureus A9763 NCBI   prephenate dehydrogenase
gi|258434723 Staphylococcus aureus A9299 NCBI   prephenate dehydrogenase
gi|258444701 Staphylococcus aureus A8115 NCBI   prephenate dehydrogenase
gi|258447464 Staphylococcus aureus A6300 NCBI   prephenate dehydrogenase
gi|258449305 Staphylococcus aureus A6224 NCBI   prephenate dehydrogenase
gi|258454685 Staphylococcus aureus A5937 NCBI   prephenate dehydrogenase
gi|81705729 organism not parsed/found in ncbi nr NCBI   RecName: Full=Prephenate dehydrogenase; Short=PDH
gi|81781638 organism not parsed/found in ncbi nr NCBI   RecName: Full=Prephenate dehydrogenase; Short=PDH
img|637092860 Staphylococcus aureus aureus N315 IMG   prephenate dehydrogenase( EC:1.3.1.12 )
img|637099875 Staphylococcus aureus aureus Mu50 IMG   prephenate dehydrogenase( EC:1.3.1.12 )
img|640904097 Staphylococcus aureus aureus Mu3 IMG   prephenate dehydrogenase
kegg|sau:SA1197   KEGG   prephenate dehydrogenase (EC:1.3.1.12)
kegg|sav:SAV1365   KEGG   prephenate dehydrogenase (EC:1.3.1.12)
kegg|saw:SAHV_1353 Staphylococcus aureus subsp. aureus Mu3 KEGG   prephenate dehydrogenase
ref|NP_371889.1 Staphylococcus aureus subsp. aureus Mu50 RefSeq   prephenate dehydrogenase
ref|NP_374478.1 Staphylococcus aureus subsp. aureus N315 RefSeq   prephenate dehydrogenase
ref|YP_001441943.1 Staphylococcus aureus subsp. aureus Mu3 RefSeq   prephenate dehydrogenase
ref|ZP_05144755.2 Staphylococcus aureus subsp. aureus Mu50-omega RefSeq   prephenate dehydrogenase
ref|ZP_05681665.1 Staphylococcus aureus A9763 RefSeq   prephenate dehydrogenase
ref|ZP_05688797.1 Staphylococcus aureus A9299 RefSeq   prephenate dehydrogenase
ref|ZP_05693030.1 Staphylococcus aureus A8115 RefSeq   prephenate dehydrogenase
ref|ZP_05695608.1 Staphylococcus aureus A6300 RefSeq   prephenate dehydrogenase
ref|ZP_05697408.1 Staphylococcus aureus A6224 RefSeq   prephenate dehydrogenase
ref|ZP_05702649.1 Staphylococcus aureus A5937 RefSeq   prephenate dehydrogenase
sp|Q7A5R7 Staphylococcus aureus (strain N315) SwissProt   Prephenate dehydrogenase
sp|Q99UB6 Staphylococcus aureus (strain Mu50 / ATCC 700699) SwissProt   Prephenate dehydrogenase
sp|TYRA_STAAM organism not parsed/found in ncbi nr SwissProt   RecName: Full=Prephenate dehydrogenase; Short=PDH
sp|TYRA_STAAN organism not parsed/found in ncbi nr SwissProt   RecName: Full=Prephenate dehydrogenase; Short=PDH
tr|A7X226 Staphylococcus aureus (strain Mu3 / ATCC 700698) TrEMBL   Prephenate dehydrogenase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search