The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|158879.11.peg.116: Staphylococcus aureus subsp. aureus N315

This feature in The SEED Viewer

NCBI Taxonomy Id: 158879

Current Assignment: Siderophore staphylobactin biosynthesis protein SbnA
Translate Function Assignments



Context on contig NC_002745 from base 122649 to 135509 (12861 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
111 124001 122649 1353 -       2: 5 2   Protein A, von Willebrand factor binding protein Spa gene_name|spa, locus|SA0107, protein_id|NP_373348.1, gi|15925815, geneID|1122881
112 125174 124422 753 - 420       dlit(15175287)
dlit(10931334)
dlit(12933857)
dlit(11254606)
staphylococcal accessory regulator A homologue gene_name|sarH1, locus|SA0108, protein_id|NP_373349.1, gi|15925816, geneID|1122882
113 126541 125543 999 - 368     1: 1   Siderophore staphylobactin ABC transporter, permease protein SirC gene_name|sirC, locus|SA0109, protein_id|NP_373350.1, gi|15925817, geneID|1122883
114 127533 126538 996 - -4     1: 1   Siderophore staphylobactin ABC transporter, permease protein SirB gene_name|sirB, locus|SA0110, protein_id|NP_373351.1, gi|15925818, geneID|1122884
115 128541 127549 993 - 15     1: 1   Siderophore staphylobactin ABC transporter, substrate-binding protein SirA gene_name|sirA, locus|SA0111, protein_id|NP_373352.1, gi|15925819, geneID|1122885
116 128772 129752 981 + 230   1: 1   Siderophore staphylobactin biosynthesis protein SbnA locus|SA0112, protein_id|NP_373353.1, gi|15925820, geneID|1122886
117 129749 130759 1011 + -4 9 6: 8 4 1 6 7 3 dlit(24485762)
dlit(21906287)
N-((2S)-2-amino-2-carboxyethyl)-L-glutamate dehydrogenase (EC 1.5.1.51) locus|SA0113, protein_id|NP_373354.1, gi|15925821, geneID|1122887
118 130780 132534 1755 + 20     1: 1   Siderophore staphylobactin biosynthesis protein SbnC @ Siderophore synthetase superfamily, group B locus|SA0114, protein_id|NP_373355.1, gi|15925822, geneID|1122888
119 132527 133783 1257 + -8     1: 1   Siderophore staphylobactin biosynthesis protein SbnD locus|SA0115, protein_id|NP_373356.1, gi|15925823, geneID|1122889
120 133773 135509 1737 + -11     1: 1   Siderophore staphylobactin biosynthesis protein SbnE @ Siderophore synthetase superfamily, group A locus|SA0116, protein_id|NP_373357.1, gi|15925824, geneID|1122890

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Siderophore_Staphylobactin SvetaG Siderophore staphylobactin biosynthesis protein SbnA


  Protein Sequence

>fig|158879.11.peg.116 Siderophore staphylobactin biosynthesis protein SbnA
MIEKSQACHDSLLDSVGQTPMVQLHQLFPKHEVFAKLEYMNPGGSMKDRPAKYIIEHGIK
HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
VAPVSTTGSIMGMSRKIKEGHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
GDRYLDLVYSDTWLEKMKSRQGVKSE

MD5 = 8cb47984c9e80fc563953d0fa8209789


  DNA Sequence

>fig|158879.11.peg.116 Siderophore staphylobactin biosynthesis protein SbnA
ttgattgaaaaaagtcaagcatgtcacgattcattgttagattctgtagggcaaacacct
atggttcaacttcatcaactatttccgaaacatgaagtgtttgcaaagttagagtatatg
aatcctggaggcagcatgaaagatcgacctgccaagtacatcattgaacatggtattaaa
catggtttaatcactgagaatacacatttaattgaaagtacttctggtaatttaggcatt
gcgttggcaatgatagctaaaatcaagggattaaaactcacgtgtgttgttgatcctaaa
atatcaccaacaaatttgaaaattattaaaagttatggtgccaatgtagaaatggttgaa
gaacctgatgcacatgggggttatttaatgactcgtattgcaaaggtgcaagaactgtta
gccactattgacgatgcatattggattaatcaatatgcgaatgagttaaattggcaatcc
cattatcatggtgcaggcacagagattgttgaaacaattaagcaacctatagattatttt
gtcgcgccagtcagcacgacaggtagcattatgggtatgagtagaaaaataaaagaaggt
catccaaacgcacaaattgttgctgttgatgcgaaagggtcagtcatttttggtgacaaa
cctattaatagagaattacctggtatcggtgctagtcgtgtacccgaaatattgaataga
tcagaaattaatcaagtgatccatgtagatgattatcaatctgctttgggctgtcgaaaa
ctgattgattatgaaggcatatttgccggaggttcaacaggctcgattattgcagcgatt
gagcagttgataacgtcaattgaagaaggtgcaacaattgtcacgattttaccagatcga
ggcgatcgttacttagatttagtttattcagatacatggttagaaaaaatgaaatcaaga
caaggagttaaatcagaatga


  DNA with Flanking Sequence

>fig|158879.11.peg.116 Siderophore staphylobactin biosynthesis protein SbnA
tatgtattcgaatttcggtttttgtgtccatgattctacagcacctacaggtttaacacc
taaagatacagcgacgtcagtggcaccttgatatagcgtaacaacacgctttggtttccc
tttaatttcagttgtacccattgcatgtttaattgaagttgtttccttatctttgttatc
agatgattgtttatttgaattcccactacatcctgctaaaacaagtaggaaagcaagcgt
aacaacaagcattttaattactttattcattgactaattagcctccttcgtgatgtatga
caatgagaatcattatcacgatttagtatgaattaaattttttcctaagtcaataaaata
tttatgatttacatgcaacttataattatttgacatataaatgcataaaaaatataatcc
taattacttgatagtgagaatcattatcaattaggtaacacacaatattatagaatttta
aatttgaggaggaagcgcttttgattgaaaaaagtcaagcatgtcacgattcattgttag
attctgtagggcaaacacctatggttcaacttcatcaactatttccgaaacatgaagtgt
ttgcaaagttagagtatatgaatcctggaggcagcatgaaagatcgacctgccaagtaca
tcattgaacatggtattaaacatggtttaatcactgagaatacacatttaattgaaagta
cttctggtaatttaggcattgcgttggcaatgatagctaaaatcaagggattaaaactca
cgtgtgttgttgatcctaaaatatcaccaacaaatttgaaaattattaaaagttatggtg
ccaatgtagaaatggttgaagaacctgatgcacatgggggttatttaatgactcgtattg
caaaggtgcaagaactgttagccactattgacgatgcatattggattaatcaatatgcga
atgagttaaattggcaatcccattatcatggtgcaggcacagagattgttgaaacaatta
agcaacctatagattattttgtcgcgccagtcagcacgacaggtagcattatgggtatga
gtagaaaaataaaagaaggtcatccaaacgcacaaattgttgctgttgatgcgaaagggt
cagtcatttttggtgacaaacctattaatagagaattacctggtatcggtgctagtcgtg
tacccgaaatattgaatagatcagaaattaatcaagtgatccatgtagatgattatcaat
ctgctttgggctgtcgaaaactgattgattatgaaggcatatttgccggaggttcaacag
gctcgattattgcagcgattgagcagttgataacgtcaattgaagaaggtgcaacaattg
tcacgattttaccagatcgaggcgatcgttacttagatttagtttattcagatacatggt
tagaaaaaatgaaatcaagacaaggagttaaatcagaatgaatagagagatgttgtattt
aaatagatcagatattgaacaagcgggaggtaatcattcacaagtttatgtggacgcatt
aacagaagcattaacagcccatgcgcacaatgattttgtacaaccgcttaagccgtattt
aagacaggatcctgaaaatggacacatcgcagatcgaattattgcaatgccaagtcatat
cggtggtgaacacgcaatttcaggtattaagtggataggtagtaagcacgacaatccatc
gaaacgtaatatggagcgtgcaagtggtgtcattattttgaatgatccagaaacgaatta
tccaattgcagttatggaagcaagtttaattagtagtatgcgtactgcagcagtttcagt
gattgcagctaagcatttggctaaaaaaggatttaaagacttaacaatcattggttgcgg
gctaatcggagacaagcaattacaaagtatgttagagcaattcgatcatattaaacgcgt
g


  Assignments for Essentially Identical Proteins

Id Organism Who ASSIGN Assignment
GO:0004124       F:cysteine synthase activity
GO:0006535       P:cysteine biosynthetic process from serine
GO:0016740       F:transferase activity
GO:0030170       F:pyridoxal phosphate binding
dbj|BAB41331.1 Staphylococcus aureus subsp. aureus N315     sbnA
fig|158879.1.peg.114 Staphylococcus aureus subsp. aureus N315 FIG   Siderophore staphylobactin biosynthesis protein SbnA
gi|13700032 Staphylococcus aureus subsp. aureus N315 NCBI   sbnA
gi|15925820 Staphylococcus aureus subsp. aureus N315 NCBI   hypothetical protein SA0112
img|637091711 Staphylococcus aureus aureus N315 IMG   hypothetical protein
kegg|sau:SA0112   KEGG   hypothetical protein
ref|NP_373353.1 Staphylococcus aureus subsp. aureus N315 RefSeq   hypothetical protein SA0112
tr|Q99X99 Staphylococcus aureus (strain N315) TrEMBL   Cysteine synthase


  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function
9 fig|158879.11.peg.117 N-((2S)-2-amino-2-carboxyethyl)-L-glutamate dehydrogenase (EC 1.5.1.51)


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search