The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1158495.3.peg.2477: Staphylococcus aureus M1462

This feature in The SEED Viewer

NCBI Taxonomy Id: 1158495

Current Assignment: FIG01107948: hypothetical protein
Translate Function Assignments



Context on contig AIZO01000011 from base 484393 to 495421 (11029 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
2472 485013 484393 621 -           LPXTG specific sortase A locus|U99_02509, protein_id|ENN09912.1, gi|478097805
2473 485207 485698 492 + 193         Phosphinothricin N-acetyltransferase (EC 2.3.1.-) locus|U99_02510, protein_id|ENN09913.1, gi|478097806
2474 487384 486485 900 - 786         L-serine dehydratase, alpha subunit (EC 4.3.1.17) locus|U99_02512, protein_id|ENN09915.1, gi|478097808
2475 488078 487398 681 - 13         L-serine dehydratase, beta subunit (EC 4.3.1.17) locus|U99_02513, protein_id|ENN09916.1, gi|478097809
2476 489124 488081 1044 - 2         Transcriptional regulator pfoR locus|U99_02514, protein_id|ENN09917.1, gi|478097810
2477 489675 489878 204 + 550         FIG01107948: hypothetical protein locus|U99_02515, protein_id|ENN09918.1, gi|478097811
2478 490070 490996 927 + 191         FIG01108553: hypothetical protein locus|U99_02516, protein_id|ENN09919.1, gi|478097812
2479 492046 491078 969 - 81         Esterase/lipase (EC 3.1.1.-) locus|U99_02517, protein_id|ENN09920.1, gi|478097813
2480 492523 492179 345 - 132     2: 2 1   Thioredoxin locus|U99_02518, protein_id|ENN09921.1, gi|478097814
2481 492975 492565 411 - 41         FIG01107953: hypothetical protein locus|U99_02519, protein_id|ENN09922.1, gi|478097815
2482 495421 493355 2067 - 379         PTS system, glucose-specific IIC component (EC 2.7.1.69) / PTS system, glucose-specific IIB component (EC 2.7.1.69) / PTS system, glucose-specific IIA component (EC 2.7.1.69) locus|U99_02520, protein_id|ENN09923.1, gi|478097816

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

This PEG is currently not present in any subsytem.

  Protein Sequence

>fig|1158495.3.peg.2477 FIG01107948: hypothetical protein
MQLSHSVKVAISIYLALIFITFTSYLVIILYTSMTGHDVSHFVLDSQHSHHGSLTQKHLS
LPEISFK

MD5 = a55de7af9f8e964f26cd26d0ed6b7a76


  DNA Sequence

>fig|1158495.3.peg.2477 FIG01107948: hypothetical protein
gtgcaattgagtcattccgttaaagttgcaatttctatctatttagcacttatctttata
acgttcacttcttatttagtcattattttatatacgagtatgactggacatgatgtatca
catttcgtgttagatagtcagcattctcatcatggatctcttacgcaaaaacatttgagt
cttcctgaaatctcatttaaatag


  DNA with Flanking Sequence

>fig|1158495.3.peg.2477 FIG01107948: hypothetical protein
gtacacccttaagaaaacgttttcaacttttatctgttatcaaatcaaatatttaagtga
aatatttgatatttgtgaaagatttttaaaatggattgtttcaaaaactacttatgttgt
cgttaatatttactaattaactttttactctatatttcaaacagttgtgtgacagttttt
tgataacttttttacatctgaaagtaagtaatatttctaaaaacttttaatatttataca
ctttatctttcgagctatttattttttgtttttgtgctgtgtttataaaaccgcacacta
tattcaaaaataacttattacacatatatttgcaataagataattaaagtaggatattat
ttttagttttctgataggaatgatgatagtctataggttgaatctttacttttttttaaa
gctaaatttacatcaacttaacaatggttggttatactgaagatgaaaatatttagtata
acttagtggaggcgataaaggtgcaattgagtcattccgttaaagttgcaatttctatct
atttagcacttatctttataacgttcacttcttatttagtcattattttatatacgagta
tgactggacatgatgtatcacatttcgtgttagatagtcagcattctcatcatggatctc
ttacgcaaaaacatttgagtcttcctgaaatctcatttaaatagtttatcctctgtgttt
caacattcatttcccatatcgattcatttatctatcatctagaccactacatcttagatg
atttttttattttctcatttcactctttcttaaaagtcgatataatgaattaaatcatta
tcatacaccgacatattttatgttgttggtgttaagttttaaaggggtgagatacttggc
gaataatcattcagctttgcgtttaaaaggaattatacttgccattgtcggtgcttgttt
atggggattaggtggtactgtttctgatttcttgttcaaatataagaatattaatgtcga
ttggtacgtcactgctcgacttgtagtcagtggtgttttcttacttattatgtacaaaat
gatgcaacccaaacgttcaatatttagcgtattccaagatcgacgtatgttaggcaaatt
acttatcttcagtatactgggcatgttagtagtacaatatgcttatatggcatctattaa
taca


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search