The SEED: an Annotation/Analysis Tool Provided by FIG
[ Subsystem Forum | Essentiality Data | FIG Tutorials | Peer-to-peer Updates | (New) Clearinghouse | SEED Control Panel | NMPDR | SEED Wiki]
[GOLD | "Complete" Genomes in SEED | ExPASy | IMG | KEGG | NCBI | TIGR cmr | UniProt | Report "Bugz"]

SEED version cvs.1555556707 (3/17/2019 22:5:7) on gum.mcs.anl.gov
The SEED


FIG search

Protein fig|1158485.3.peg.1787: Staphylococcus aureus M1311

This feature in The SEED Viewer

NCBI Taxonomy Id: 1158485

Current Assignment: Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
Translate Function Assignments



Context on contig AIZE01000018 from base 199984 to 227488 (27505 bp)

Fid Start End Size
(nt)
  Gap Find
best
clusters
Pins Fc-sc SS Ev Function Aliases
1784 199984 203424 3441 +           Uncharacterized protein Bsub YpbR locus|U7O_01830, protein_id|ENM74589.1, gi|478062143
1785 203444 204322 879 + 19         Probable 5'-3' exonuclease Bsu YpcP locus|U7O_01831, protein_id|ENM74590.1, gi|478062144
1786 204918 206036 1119 + 595     1: 2   Alanine dehydrogenase (EC 1.4.1.1) locus|U7O_01832, protein_id|ENM74591.1, gi|478062145
1787 206131 207171 1041 + 94     1: 1   Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17) locus|U7O_01833, protein_id|ENM74592.1, gi|478062146
1788 207202 208524 1323 + 30         Amino acid permease locus|U7O_01834, protein_id|ENM74593.1, gi|478062147
1789 208681 210069 1389 + 156         major facilitator superfamily MFS_1 locus|U7O_01835, protein_id|ENM74594.1, gi|478062148
1790 210476 227488 17013 + 406         extracellular matrix-binding protein ebh locus|U7O_01836, protein_id|ENM74595.1, gi|478062149

Annotation History   /   View All Related Annotations Help on Annotations



  Subsystems in Which This Protein Plays a Role

Subsystem Curator Role
Leucine,_Isoleucine,_and_Valine_biosynthesis_PanGenomes Acharya_Geeta_user Threonine dehydratase, catabolic (EC 4.3.1.19)


  Protein Sequence

>fig|1158485.3.peg.1787 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
MTTNTVTLQTAHIVSLGDIEEAKASIKPFIRRTPLIKSMYLSQSITKGNVFLKLENMQFT
GSFKFRGASNKINHLTDEQKEKGIIAASAGNHAQGVALTAKLLGINATIVMPETAPQAKQ
QATKGYGAQVILKGKNFNETRLYMEELAKENGMTIVHPYDDKFVMAGQGTIGLEILDDIW
NVNTVIVPVGGGGLIAGIATALKSFNPSIHIIGVQSENVHGMAESFYKRDLTEHRDDSTI
ADGCDVKVPGEQTYEVVKHLVDEFILVTEEEIEHAMKDLMQRAKIITEGAGALPTAAILS
GKIDKKWLEDKNVVALVSGGNVDLTRVSGVIEHGLNIADTSKGVVG

MD5 = 157f907adf316f82a54a775f750c4082


  DNA Sequence

>fig|1158485.3.peg.1787 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
atgacaaccaacacagttacattacaaacagcacacattgtaagtttaggagatattgaa
gaagcgaaagcaagcatcaaaccatttattagacgaacaccactcattaaatctatgtat
ttaagtcaaagtatcactaaaggtaatgtgtttttaaaattagaaaatatgcagttcaca
ggatctttcaaattcagaggtgcaagtaacaaaatcaatcatttaacagatgaacaaaaa
gaaaaaggtattatcgctgcatcggctggaaaccatgcacaaggcgtagctttaacagca
aaactattaggtataaatgccacaatcgtgatgcctgaaaccgcaccacaagcgaaacaa
caagcaacaaaaggctatggtgctcaagttattttaaaaggtaaaaactttaacgaaact
agactttatatggaagaattagcgaaagaaaatggtatgacaatcgttcatccatatgac
gataagtttgtaatggcaggccaaggaacaattggtttagaaattttagatgatatttgg
aatgtgaatacagtaatcgtacctgttggcggcggtggattaattgcaggtattgccacc
gcgttaaaatctttcaatccttcaattcatattattggtgttcaatctgaaaatgttcac
ggtatggctgagtcattctataagagagatttaactgagcatcgtgatgatagcacaatt
gcagatggttgtgatgtcaaagttcctggtgaacaaacatatgaggtagttaaacattta
gtagatgaatttattcttgttactgaagaagaaatcgaacatgcaatgaaagatttaatg
caacgtgccaaaattattactgaaggtgcaggtgcattgccgactgctgcaattttaagt
gggaaaattgataaaaaatggcttgaggataaaaatgttgtggcattagtttcaggcgga
aacgttgacttaactagagtgtcaggtgtcattgaacatggactaaatattgcagataca
agcaagggtgtggtaggttaa


  DNA with Flanking Sequence

>fig|1158485.3.peg.1787 Threonine dehydratase, catabolic (EC 4.3.1.19) @ L-serine dehydratase, (PLP)-dependent (EC 4.3.1.17)
gacaattttaattcctggtgcaaaaccaccaaaattagttacacgtgagatggttaaatc
aatgaaaaaaggttcagttttaatcgatatagctattgatcaaggtggaaccattgaaac
aatcaaaccaactacaatttctgatccagtgtatgaagaagaaggcgtaattcattacgg
tgtaccaaaccaaccaggtgcagttccaagaacgtcaacaatggcattagcacaagggaa
tattgattatattttagaaatttgcgacaaaggcctagaacaggcaatcaaggacaatga
agcgttaagtactggtgtaaacgtatacaaaggacaagtgacaaaccaaggattagcttc
atcacatgatttagattttaaagagattaaggatgttattgaataaatacccatttactt
gaatgagcgtgaaatgaatattttaaataaagcaatatagtatggactaaaaatttacaa
aacggaaggatgtaatcattatgacaaccaacacagttacattacaaacagcacacattg
taagtttaggagatattgaagaagcgaaagcaagcatcaaaccatttattagacgaacac
cactcattaaatctatgtatttaagtcaaagtatcactaaaggtaatgtgtttttaaaat
tagaaaatatgcagttcacaggatctttcaaattcagaggtgcaagtaacaaaatcaatc
atttaacagatgaacaaaaagaaaaaggtattatcgctgcatcggctggaaaccatgcac
aaggcgtagctttaacagcaaaactattaggtataaatgccacaatcgtgatgcctgaaa
ccgcaccacaagcgaaacaacaagcaacaaaaggctatggtgctcaagttattttaaaag
gtaaaaactttaacgaaactagactttatatggaagaattagcgaaagaaaatggtatga
caatcgttcatccatatgacgataagtttgtaatggcaggccaaggaacaattggtttag
aaattttagatgatatttggaatgtgaatacagtaatcgtacctgttggcggcggtggat
taattgcaggtattgccaccgcgttaaaatctttcaatccttcaattcatattattggtg
ttcaatctgaaaatgttcacggtatggctgagtcattctataagagagatttaactgagc
atcgtgatgatagcacaattgcagatggttgtgatgtcaaagttcctggtgaacaaacat
atgaggtagttaaacatttagtagatgaatttattcttgttactgaagaagaaatcgaac
atgcaatgaaagatttaatgcaacgtgccaaaattattactgaaggtgcaggtgcattgc
cgactgctgcaattttaagtgggaaaattgataaaaaatggcttgaggataaaaatgttg
tggcattagtttcaggcggaaacgttgacttaactagagtgtcaggtgtcattgaacatg
gactaaatattgcagatacaagcaagggtgtggtaggttaaaacatttaatctgaaaaat
gaggtgtaattatgtcaaatggtaaagaattacaaaaaaatataggtttcttctcagcgt
ttgcgattgtaatggggacagtcattggttctggtgtgttcttcaaaatatcaaacgtga
cagaagtaacaggaacagcaggaatggccttgtttgtatggttcctaggcggcatcatta
ccatttgtgcggggttaacagcagcagaacttgctgctgcgatccctgaaacaggtggct
taacaaagtatatagaatatacatacggtgatttctggggcttcctatcaggctgggcac
aatcatttatttattttccagcaaacgtcgcagccttatcaatcgtatttgcgactcaat
taattaatttattccatttatcggcaggttctttaataccaattgcgatcgcttcggcct
tatcaatcgtgttgatcaatttccttggttctaaagcaggcggtattttacaatctgtta
c


  Assignments for Essentially Identical Proteins

No essentially identical proteins found

  Links to Related Entries in Other Sites

This PEG has no links.
add a new link


  Functional Coupling

Score Peg Function


  Attributes

Help on Attributes

Key
Link Explains Key
Value


  Protein Families

No protein families found

Compare Regions

Compared Regions in SeedViewer



Similarities

Max sims:    Max expand:    Max E-val:       Show Env. samples:    Show aliases:
   Sort by    Group by genome:

Help with SEED similarities options


|   Psi-Blast  |   TMpred  |   TMHMM  |   Gram negative PSORT  |   Gram negative SignalP  |   Gram positive PSORT  |   Gram positive SignalP  |   LipoP  |   Radar  |   PPSearch  |   Gram negative CELLO  |   Gram positive CELLO  |   ProDom  |   PDB  |   RNAFold  |

> Show tool descriptions


FIG search